Anti-Calretinin antibody [1F5H1] (ab204990)

Mouse monoclonal Calretinin antibody [1F5H1]. Validated in WB, IHC, Flow Cyt and tested in Human. Independently reviewed in 1 review(s). Immunogen corresponding to recombinant full length protein.

Overview

  • Product name

    Anti-Calretinin antibody [1F5H1]
    See all Calretinin primary antibodies
  • Description

    Mouse monoclonal [1F5H1] to Calretinin
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Calretinin aa 1-271. (Purified from E.coli).
    Sequence:

    MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK ARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLL CFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEP KLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEF NAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSL AEAGKLYRKDLEIVLCSEPPM


    Database link: P22676

  • Positive control

    • Human Calretinin (aa1-271) recombinant protein; Calretinin (aa1-271)-hIgGFc transfected HEK293 cell lysate; A549 cells; Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1F5H1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 31 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human brain tissue labeling Calretinin with ab204990 at 1/200 dilution with DAB staining.

  • Anti-Calretinin antibody [1F5H1] (ab204990) at 1/500 dilution + Human Calretinin (aa1-271) recombinant protein

    Predicted band size: 31 kDa



    Expected MWt is 57.5 kDa.

  • All lanes : Anti-Calretinin antibody [1F5H1] (ab204990) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Calretinin (aa1-271)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 31 kDa

  • Flow cytometric analysis of A549 cells labeling Calretinin with ab204990 at 1/200 dilution (green), compared to a negative control (red).

References

ab204990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rhesus monkey Tissue sections (Midbrain)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium Citrate
Permeabilization
Yes - 0.25% Triton-X
Specification
Midbrain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 29 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up