Overview

  • Product name

  • Description

    Rabbit polyclonal to Calretinin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Calretinin aa 132-264.
    Sequence:

    LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLP VQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKN KKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV


    Database link: P22676

  • Positive control

    • WB: Human cerebral cortex tissue lysate. Mouse cerebellum tissue lysate. NIH/3T3 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Mouse substantia nigra, hippocampus, medulla, hypothalamus and hindbrain tissue. Human cerebral cortex, testis and liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 32 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse hippocampus tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human testis tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling Calretinin using ab244299 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-Calretinin antibody (ab244299) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate

    Predicted band size: 32 kDa

  • All lanes : Anti-Calretinin antibody (ab244299) at 0.4 µg/ml

    Lane 1 : U-2 OS (Human bone osteosarcoma epithelial cell line) transfected with control siRNA
    Lane 2 : U-2 OS transfected with siRNA probe #1
    Lane 3 : U-2 OS transfected with siRNA probe #2

    Predicted band size: 32 kDa

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse hypothalamus tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse medulla tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse hindbrain tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse substantia nigra tissue stained for Calretinin with ab244299 at a 1/50 dilution in immunohistochemical analysis.

References

ab244299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Brain section - 50um)
Antigen retrieval step
None
Permeabilization
Yes - PBS-T 3 x 5mn
Specification
Brain section - 50um
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 13 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up