Overview

  • Product name

    Anti-CaM KMT antibody
  • Description

    Rabbit polyclonal to CaM KMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human CaM KMT aa 270-319 (C terminal).
    Sequence:

    QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL


    Database link: Q7Z624

  • Positive control

    • HepG2 cell lysate.
  • General notes

    Previously labelled as CLNMT.

Properties

Applications

Our Abpromise guarantee covers the use of ab157664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa.

Target

Images

  • Anti-CaM KMT antibody (ab157664) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    Predicted band size: 36 kDa

References

ab157664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up