Overview

  • Product name

    Anti-CamKII gamma antibody [6A4A10]
    See all CamKII gamma primary antibodies
  • Description

    Mouse monoclonal [6A4A10] to CamKII gamma
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CamKII gamma aa 322-481. Expressed in E. Coli.
    Sequence:

    NKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVV HNATDGIKGSTESCNTTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLC SSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEG MDFHKFYFEN


    Database link: Q13555

  • Positive control

    • Human CamKII gamma (aa: 322-481) recombinant protein; Human CamKII gamma (aa: 322-481)-hIgGFc transfected HEK293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab202024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 63 kDa.

Target

  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • CaM kinase II antibody
    • CaM kinase II gamma chain antibody
    • CaM kinase II subunit gamma antibody
    • CAMK antibody
    • CAMK II antibody
    • CaMK II subunit gamma antibody
    • CAMK2G antibody
    • CAMKG antibody
    • CAMKII antibody
    see all

Images

  • Anti-CamKII gamma antibody [6A4A10] (ab202024) at 1/500 dilution + Human CamKII gamma (aa: 322-481) recombinant protein. at 1 µg

    Predicted band size: 63 kDa



    Expected MW is 44 kDa

  • All lanes : Anti-CamKII gamma antibody [6A4A10] (ab202024) at 1/500 dilution

    Lane 1 : Non transfected HEK293 cell lysate.
    Lane 2 : Human CamKII gamma (aa: 322-481)-hIgGFc transfected HEK293 cell lysate.

    Lysates/proteins at 1 µg per lane.

    Predicted band size: 63 kDa

References

ab202024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up