Anti-CAMKIV antibody (ab235058)
Key features and details
- Rabbit polyclonal to CAMKIV
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CAMKIV antibody
See all CAMKIV primary antibodies -
Description
Rabbit polyclonal to CAMKIV -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CAMKIV aa 304-473.
Sequence:ALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSAS SSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAE LMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKT VEEAAAPREGQGSSAVGFEVPQQDVILPEY
Database link: Q16566 -
Positive control
- WB: HEK-293T cell lysate. IP: Jurkat whole cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235058 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP | 1/200 - 1/2000. | |
WB | 1/1000 - 1/5000. |
Target
-
Function
Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May be involved in transcriptional regulation. May be involved in regulation of microtubule dynamics. In vitro, phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. May be involved in spermatogenesis. May play a role in the consolidation/retention of hippocampus-dependent long-term memory. -
Tissue specificity
Expressed in epithelial ovarian cancer tissue. -
Sequence similarities
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Contains 1 protein kinase domain. -
Post-translational
modificationsAutophosphorylated and phosphorylated by CAMKK1 and CAMKK2 (By similarity). Dephosphorylated by serine/threonine protein phosphatase 2A, probably on Thr-200. -
Cellular localization
Cytoplasm. Nucleus. Substantial localization in certain neuronal nuclei. In spermatids associated with chromatin and nuclear matrix. - Information by UniProt
-
Database links
- Entrez Gene: 814 Human
- Omim: 114080 Human
- SwissProt: Q16566 Human
- Unigene: 591269 Human
-
Alternative names
- Brain Ca(2+) calmodulin dependent protein kinase type 4 antibody
- Brain Ca(2+) calmodulin dependent protein kinase type IV antibody
- Brain Ca++-calmodulin dependent protein kinase type IV antibody
see all
Images
-
Anti-CAMKIV antibody (ab235058) at 1/1000 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution -
CAMKIV was immunoprecipitated from Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate with ab235058. Western blot was performed from the immunoprecipitate using ab235058 at 1/200 dilution. HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG was used as the secondary antibody at 1/50000 dilution.
Lane 1: 1 µg rabbit monoclonal IgG instead of ab235058 in Jurkat whole cell lysate.
Lane 2: ab235058 IP in Jurkat whole cell lysate.
Lane 3: Jurkat whole cell lysate 20 µg (Input).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab235058 has not yet been referenced specifically in any publications.