Anti-CAMKIV antibody (ab235058)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CAMKIV antibody
See all CAMKIV primary antibodies -
Description
Rabbit polyclonal to CAMKIV -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CAMKIV aa 304-473.
Sequence:ALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSAS SSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAE LMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKT VEEAAAPREGQGSSAVGFEVPQQDVILPEY
Database link: Q16566 -
Positive control
- WB: HEK-293T cell lysate. IP: Jurkat whole cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235058 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IP | 1/200 - 1/2000. | |
| WB | 1/1000 - 1/5000. |
Target
-
Function
Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. May be involved in transcriptional regulation. May be involved in regulation of microtubule dynamics. In vitro, phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. May be involved in spermatogenesis. May play a role in the consolidation/retention of hippocampus-dependent long-term memory. -
Tissue specificity
Expressed in epithelial ovarian cancer tissue. -
Sequence similarities
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
Contains 1 protein kinase domain. -
Post-translational
modificationsAutophosphorylated and phosphorylated by CAMKK1 and CAMKK2 (By similarity). Dephosphorylated by serine/threonine protein phosphatase 2A, probably on Thr-200. -
Cellular localization
Cytoplasm. Nucleus. Substantial localization in certain neuronal nuclei. In spermatids associated with chromatin and nuclear matrix. - Information by UniProt
-
Database links
- Entrez Gene: 814 Human
- Omim: 114080 Human
- SwissProt: Q16566 Human
- Unigene: 591269 Human
-
Alternative names
- Brain Ca(2+) calmodulin dependent protein kinase type 4 antibody
- Brain Ca(2+) calmodulin dependent protein kinase type IV antibody
- Brain Ca++-calmodulin dependent protein kinase type IV antibody
see all
Images
-
Western blot - Anti-CAMKIV antibody (ab235058)Anti-CAMKIV antibody (ab235058) at 1/1000 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution -
Immunoprecipitation - Anti-CAMKIV antibody (ab235058)CAMKIV was immunoprecipitated from Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate with ab235058. Western blot was performed from the immunoprecipitate using ab235058 at 1/200 dilution. HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG was used as the secondary antibody at 1/50000 dilution.
Lane 1: 1 µg rabbit monoclonal IgG instead of ab235058 in Jurkat whole cell lysate.
Lane 2: ab235058 IP in Jurkat whole cell lysate.
Lane 3: Jurkat whole cell lysate 20 µg (Input).
Datasheets and documents
References
ab235058 has not yet been referenced specifically in any publications.
