Overview

  • Product name

  • Description

    Rabbit polyclonal to CAMKK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CAMKK2 aa 2-137.
    Sequence:

    SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMES FIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSL QERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS


    Database link: Q96RR4

  • Positive control

    • IHC-P: Human esophagus tissue. WB: Human cerebral cortex lysate. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 65 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. Seems to be involved in hippocampal activation of CREB1.
  • Tissue specificity

    Ubiquitously expressed with higher levels in the brain. Intermediate levels are detected in spleen, prostate, thyroid and leukocytes. The lowest level is in lung.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain

    The autoinhibitory domain overlaps with the calmodulin binding region and may be involved in intrasteric autoinhibition.
    The RP domain (arginine/proline-rich) is involved in the recognition of CAMKI and CAMK4 as substrates.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium/calmodulin dependent protein kinase beta antibody
    • Calcium/calmodulin dependent protein kinase kinase 2 antibody
    • Calcium/calmodulin dependent protein kinase kinase 2 beta antibody
    • Calcium/calmodulin dependent protein kinase kinase beta antibody
    • Calcium/calmodulin-dependent protein kinase kinase 2 antibody
    • Calcium/calmodulin-dependent protein kinase kinase beta antibody
    • CaM kinase kinase beta antibody
    • CaM KK beta antibody
    • CaM-kinase kinase 2 antibody
    • CaM-kinase kinase beta antibody
    • CaM-KK 2 antibody
    • CaM-KK beta antibody
    • CaMKK 2 antibody
    • CAMKK antibody
    • CaMKK beta antibody
    • CAMKK beta protein antibody
    • Camkk2 antibody
    • CAMKKB antibody
    • KKCC2_HUMAN antibody
    see all

Images

  • Anti-CAMKK2 antibody (ab223740) at 1/100 dilution + Human cerebral cortex lysate

    Predicted band size: 65 kDa

  • Paraffin-embedded human esophagus tissue stained for CAMKK2 using ab223740 at 1/500 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for CAMKK2 (green) using ab223740 at 4 µg/ml in ICC/IF.

References

ab223740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up