Overview

  • Product name

  • Description

    Rabbit polyclonal to CAMKV
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human CAMKV aa 213-313.
    Sequence:

    LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDL VTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAK W


    Database link: Q8NCB2

  • Positive control

    • IHC-P: Human cerebral cortex. ICC/IF: Caco-2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Does not appear to have detectable kinase activity.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle membrane. Predominantly observed in association with the plasma membrane of soma and in neurites, both axons and dendrites. May be associated with vesicular structures (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • 1G5 antibody
    • CaM kinase like vesicle associated antibody
    • CaM kinase like vesicle associated protein antibody
    • CaM kinase-like vesicle-associated protein antibody
    • camkv antibody
    • CAMKV_HUMAN antibody
    • MGC8407 antibody
    • OTTHUMP00000212745 antibody
    • OTTHUMP00000212766 antibody
    • VACAMKL antibody
    • Vesicle associated calmodulin binding protein antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for CAMKV (green) using ab224072 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human cerebral cortex tissue stained for CAMKV using ab224072 at 1/50 dilution in immunohistochemical analysis.

References

ab224072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up