Overview

  • Product name

  • Description

    Rabbit polyclonal to CAMLG/CAML
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CAMLG/CAML aa 19-184. (Expressed in E.coli).
    Sequence:

    GSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQ DSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFI KPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQ LISEKPSQEDGNTTEE


    Database link: P49069

  • Positive control

    • WB: Recombinant human CAMLG/CAML protein; HepG2 and Jurkat cell lysates; Rat and mouse cerebrum lysates. IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as CAMLG

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231567 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 33 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    The immunosuppressant drug cyclosporin A blocks a calcium dependent signal from the T cell receptor (TCR) that normally leads to T cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [Entrez Gene]
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • calcium modulating cyclophilin ligand antibody
    • calcium modulating ligand antibody
    • Calcium signal modulating cyclophilin ligand antibody
    • CAML antibody
    • cyclophilin B binding protein antibody
    • MGC163197 antibody
    see all

Images

  • All lanes : Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml

    Lane 1 : Wild type jurkat cell
    Lane 2 : CAMLG/CAML knockout jurkat cell

    Predicted band size: 33 kDa

  • Formalin-fixed, paraffin-embedded human Cerebellum tissue stained for ab231567 using ab231567 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human Cerebrum tissue stained for ab231567 using ab231567 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml + Recombinant human CAMLG/CAML protein

    Predicted band size: 33 kDa

  • Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 33 kDa

  • Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 33 kDa

  • Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 33 kDa

  • Anti-CAMLG/CAML antibody (ab231567) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 33 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for ab231567 using ab231567 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up