Overview

  • Product name

  • Description

    Rabbit polyclonal to CAMLG/CAML
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CAMLG/CAML aa 1-189.
    Sequence:

    MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGF HRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG GVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRH GLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFR


    Database link: P49069

  • Positive control

    • WB: Jurkat, HEK-293, U-87 MG and SH-SY5Y whole cell lysates. IHC-P: HepG2 cells. IP: HEK-293 whole cell lysate.
  • General notes

     This product was previously labelled as CAMLG

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 33 kDa.
IP 1/200 - 1/2000.
ICC/IF 1/50 - 1/500.

Target

  • Relevance

    The immunosuppressant drug cyclosporin A blocks a calcium dependent signal from the T cell receptor (TCR) that normally leads to T cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [Entrez Gene]
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • calcium modulating cyclophilin ligand antibody
    • calcium modulating ligand antibody
    • Calcium signal modulating cyclophilin ligand antibody
    • CAML antibody
    • cyclophilin B binding protein antibody
    • MGC163197 antibody
    see all

Images

  • All lanes : Anti-CAMLG/CAML antibody (ab236655) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 4 : SH-SY5Y (Human neuroblastoma cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for CAMLG/CAML (green) using ab236655 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

  • CAMLG/CAML was immunoprecipitated from 500 μg HEK-293 (human epithelial cell line from embryonic kidney) whole cell extract with ab236655 at 1/200 dilution.

    Lane 1: Control rabbit IgG (1 μg) IP in HEK-293 whole cell lysate.

    Lane 2: ab236655 IP in HEK-293 whole cell lysate.

    Lane 3: HEK-293 whole cell lysate (10 μg) Input.

    HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up