Overview

  • Product name

  • Description

    Rabbit polyclonal to CAMLG/CAML
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human CAMLG/CAML aa 36-85 (N terminal).
    Sequence:

    LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV


    Database link: NP_001736

  • Positive control

    • Human fetal liver lysate.
  • General notes

     This product was previously labelled as CAMLG

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    The immunosuppressant drug cyclosporin A blocks a calcium dependent signal from the T cell receptor (TCR) that normally leads to T cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [Entrez Gene]
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • calcium modulating cyclophilin ligand antibody
    • calcium modulating ligand antibody
    • Calcium signal modulating cyclophilin ligand antibody
    • CAML antibody
    • cyclophilin B binding protein antibody
    • MGC163197 antibody
    see all

Images

  • Anti-CAMLG/CAML antibody (ab85480) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa
    Observed band size: 30 kDa
    why is the actual band size different from the predicted?



    Gel concentration 12%

References

ab85480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up