Overview

  • Product name

  • Description

    Rabbit polyclonal to CAND1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CAND1 aa 404-467 (internal sequence).
    Sequence:

    QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQC CFNMLTELVNVLPG


    Database link: Q86VP6

  • Positive control

    • Human kidney tissue, RT-4, U-251 MG and tonsil lysates. SiHa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 136 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Enhances transcription from various types of promoters (By similarity). Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins.
  • Sequence similarities

    Belongs to the CAND family.
    Contains 27 HEAT repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAND 1 antibody
    • Cand1 antibody
    • CAND1_HUMAN antibody
    • Cullin associated and neddylation dissociated 1 antibody
    • Cullin associated and neddylation dissociated protein 1 antibody
    • Cullin associated NEDD8 dissociated protein 1 antibody
    • Cullin-associated and neddylation-dissociated protein 1 antibody
    • Cullin-associated NEDD8-dissociated protein 1 antibody
    • DKFZP434M1414 antibody
    • FLJ10114 antibody
    • FLJ10929 antibody
    • FLJ38691 antibody
    • FLJ90441 antibody
    • KIAA0829 antibody
    • p120 CAND1 antibody
    • TATA binding protein interacting protein 120A antibody
    • TBP interacting protein antibody
    • TBP interacting protein of 120 kDa A antibody
    • TBP Interacting Protein TIP120A antibody
    • TBP-interacting protein 120A antibody
    • TBP-interacting protein of 120 kDa A antibody
    • TIP120 antibody
    • TIP120 protein antibody
    • TIP120A antibody
    see all

Images

  • All lanes : Anti-CAND1 antibody (ab204554) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 136 kDa

  • Immunofluorescence analysis of SiHa cells labeling CAND1 with ab204554 at 4 µg/mL.

    Fixation/Permeabilization: PFA/Triton X-100

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling CAND1 with ab204554 at 1/1000 dilution.

References

ab204554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up