Overview

  • Product name

    Anti-CAND2 antibody
  • Description

    Rabbit polyclonal to CAND2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human CAND2 aa 1-50 (N terminal).
    Sequence:

    MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVV


    Database link: NP_036430

  • Positive control

    • Fetal muscle lysate.
  • General notes

    Previously labelled as TIP120B.

Properties

Applications

Our Abpromise guarantee covers the use of ab82914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 123 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.

Target

  • Function

    May play a role in the assembly of ubiquitin ligase complexes and modulate the ubiquitination of target proteins. May be a transcription regulator.
  • Sequence similarities

    Belongs to the CAND family.
    Contains 23 HEAT repeats.
  • Post-translational
    modifications

    Ubiquitinated and targeted for proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAND 2 antibody
    • Cand2 antibody
    • CAND2_HUMAN antibody
    • Cullin associated and neddylation dissociated protein 2 antibody
    • Cullin associated and neddylation dissociated protein 2 putative antibody
    • Cullin associated NEDD8 dissociated protein 2 antibody
    • Cullin-associated and neddylation-dissociated protein 2 antibody
    • Cullin-associated NEDD8-dissociated protein 2 antibody
    • KIAA0667 antibody
    • p120 CAND2 antibody
    • TATA binding protein interacting protein 120B antibody
    • TBP interacting protein antibody
    • TBP-interacting protein 120B antibody
    • TBP-interacting protein of 120 kDa B antibody
    • TIP120B antibody
    • Tp120b antibody
    see all

Images

  • Anti-CAND2 antibody (ab82914) at 1 µg/ml + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 123 kDa
    Observed band size: 123 kDa

References

ab82914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up