Anti-Candidapepsin-9 antibody (ab234680)
Key features and details
- Rabbit polyclonal to Candidapepsin-9
- Suitable for: WB
- Reacts with: Species independent
- Isotype: IgG
Overview
-
Product name
Anti-Candidapepsin-9 antibody -
Description
Rabbit polyclonal to Candidapepsin-9 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Species independent
Predicted to work with: Candida albicans -
Immunogen
Recombinant full length protein corresponding to Candida albicans Candidapepsin-9 aa 18-544. (with N-terminal B2M tag).
Sequence:AKAPFKIDFEVRRGESKDDLSPEDDSNPRFVKRDGSLDMTLTNKQTFYMA TLKIGSNEDENRVLEDTGSSDLWVMSHDLKCVSAPISKRNERSFGHGTGV KLNERELMQKRKNLYQPSRTIETDEEKEASEKIHNKLFGFGSIYSTVYIT EGPGAYSTFSPLVGTEGGSGGSGGSNTCRSYGSFNTENSDTFKKNNTNDF EIQYADDTSAIGIWGYDDVTISNVTVKDLSFAIANETSSDVGVLGIGLPG LEVTTQLRYTYQNLPLKLKADGIIAKSLYSLYLNTADAKAGSILFGAIDH AKYQGDLVTVKMMRTYSQISYPVRIQVPVLKIDVESSSGSTTNILSGTTG VVLDTGSTLSYVFSDTLQSLGKALNGQYSNSVGAYVVNCNLADSSRTVDI EFGGNKTIKVPISDLVLQASKSTCILGVMQQSSSSSYMLFGDNILRSAYI VYDLDDYEVSLAQVSYTNKESIEVIGASGITNSSGSGTTSSSGTSTSTST RHSAGSIISNPVYGLLLSLLISYYVLV
Database link: O42779 -
Positive control
- WB: Recombinant Candida albicans Candidapepsin-9 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab234680 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 75 kDa (predicted molecular weight: 59 kDa). |
Images
-
All lanes : Anti-Candidapepsin-9 antibody (ab234680) at 1/500 dilution
Lane 1 : Recombinant Candida albicans Candidapepsin-9 protein, 80 ng
Lane 2 : Recombinant Candida albicans Candidapepsin-9 protein, 40 ng
Lane 3 : Recombinant Candida albicans Candidapepsin-9 protein, 20 ng
Lane 4 : Recombinant Candida albicans Candidapepsin-9 protein, 10 ng
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 59 kDa
Observed band size: 75 kDa why is the actual band size different from the predicted?Predicted MWt of recombinant protein with N-terminal B2M tag: 75 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234680 has not yet been referenced specifically in any publications.