Overview

  • Product name

    Anti-CANT1 antibody
  • Description

    Rabbit polyclonal to CANT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CANT1 aa 120-220.
    Sequence:

    QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSD LIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAV K


    Database link: Q8WVQ1

  • Positive control

    • WB: RT4 and U-251 MG sp cell lysates. IHC-P: Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 45 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. Has very low activity towards ADP and even lower activity towards ATP. Does not hydrolyze AMP and GMP.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in CANT1 are the cause of Desbuquois dysplasia (DBQD) [MIM:251450]. A chondrodysplasia characterized by severe prenatal and postnatal growth retardation (less than -5 SD), joint laxity, short extremities, progressive scoliosis, round face, midface hypoplasia, prominent bulging eyes. The main radiologic features are short long bones with metaphyseal splay, a 'Swedish key' appearance of the proximal femur (exaggerated trochanter), and advance carpal and tarsal bone age. Two forms of Desbuquois dysplasia are distinguished on the basis of the presence (type 1) or absence (type 2) of characteristic hand anomalies: an extra ossification center distal to the second metacarpal, delta phalanx, bifid distal thumb phalanx, and phalangeal dislocations.
  • Sequence similarities

    Belongs to the apyrase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane. Processed form: Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apyrase antibody
    • Apyrase homolog antibody
    • Ca2+ dependent endoplasmic reticulum nucleoside diphosphatase antibody
    • Calcium activated nucleotidase 1 antibody
    • CANT 1 antibody
    • CANT1 antibody
    • CANT1_HUMAN antibody
    • Putative MAPK activating protein PM09 antibody
    • Putative MAPK-activating protein PM09 antibody
    • Putative NF kappa B activating protein 107 antibody
    • Putative NF-kappa-B-activating protein 107 antibody
    • SCAN 1 antibody
    • SCAN-1 antibody
    • SHAPY antibody
    • Soluble Ca activated nucleotidase isozyme 1 antibody
    • Soluble calcium activated nucleotidase 1 antibody
    • Soluble calcium activated nucleotidase SCAN 1 antibody
    • Soluble calcium-activated nucleotidase 1 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for CANT1 using ab224420 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-CANT1 antibody (ab224420) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 45 kDa

References

ab224420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up