Overview

  • Product name

  • Description

    Rabbit polyclonal to Caprin-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Caprin-1 aa 214-349.
    Sequence:

    LWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAA SAPAVEDQVPEAEPEPAEEYTEQSEVESTEYVNRQFMAETQFTSGEKEQV DEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQ


    Database link: Q14444

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human testis, skeletal muscle, fallopian tube and cerebral cortex tissue. WB: Control siRNA transfected Rh30 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml.

Target

  • Function

    May regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the caprin family.
  • Cellular localization

    Cytoplasm > cytosol. Cell projection > dendrite. Associated with RNA granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • activation/proliferation-associated protein 1 antibody
    • CAPR1_HUMAN antibody
    • Caprin-1 antibody
    • CAPRIN1 antibody
    • Cell cycle-associated protein 1 antibody
    • Cytoplasmic activation- and proliferation-associated protein 1 antibody
    • cytoplasmic activation/proliferation-associated protein-1 antibody
    • GPI-anchored membrane protein 1 antibody
    • GPI-anchored protein p137 antibody
    • GPI-p137 antibody
    • GPIAP1 antibody
    • GPIP137 antibody
    • M11S1 antibody
    • Membrane component chromosome 11 surface marker 1 antibody
    • p137GPI antibody
    • RNA granule protein 105 antibody
    • RNG105 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling Caprin-1 using ab244360 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for Caprin-1 with ab244360 at a 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human testis tissue stained for Caprin-1 with ab244360 at a 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for Caprin-1 with ab244360 at a 1/500 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for Caprin-1 with ab244360 at a 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-Caprin-1 antibody (ab244360) at 0.4 µg/ml

    Lane 1 : Control siRNA transfected Rh30 cell lysate
    Lane 2 : siRNA probe #1 transfected Rh30 cell lysate

References

ab244360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up