Overview

  • Product name

  • Description

    Rabbit polyclonal to CAPZA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CAPZA1 aa 211-252.
    Sequence:

    DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSD


    Database link: P52907

  • Positive control

    • WB: HeLa, HEK-293, NIH/3T3 and THP-1 whole cell lysate. IHC-P: Human testis tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 33 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similarities

    Belongs to the F-actin-capping protein alpha subunit family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cap Z antibody
    • Cappa 1 antibody
    • Cappa1 antibody
    • Capping protein (actin filament) muscle Z line alpha 1 antibody
    • Capping protein alpha 1 antibody
    • Capping protein muscle Z line alpha 1 antibody
    • CapZ alpha 1 antibody
    • CapZ alpha-1 antibody
    • CAPZ antibody
    • CAPZA 1 antibody
    • Capza1 antibody
    • CAZ 1 antibody
    • CAZ1 antibody
    • CAZA1_HUMAN antibody
    • F actin capping protein alpha 1 subunit antibody
    • F-actin-capping protein subunit alpha-1 antibody
    see all

Images

  • All lanes : Anti-CAPZA1 antibody (ab234836) at 1/500 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293 (Human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : NIH/3T3 (Mouse embryo fibroblast cell line) whole cell lysate
    Lane 4 : THP-1 (Human monocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for CAPZA1 (Green) using ab234836 at 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testis tissue stained for CAPZA1 using ab234836 at 1/100 dilution in immunohistochemical analysis.

References

ab234836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up