Overview

  • Product name
  • Description
    Rabbit polyclonal to CAPZA2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CAPZA2 aa 1-286.
    Sequence:

    MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGA AHAFAQYNLDQFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDH LRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDG QQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYE DGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTM SDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA


    Database link: P47755

  • Positive control
    • HeLa, THP1, 22RV1, Mouse brain and Mouse heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.

Target

  • Function
    F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.
  • Sequence similarities
    Belongs to the F-actin-capping protein alpha subunit family.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAPPA2 antibody
    • Capping protein (actin filament) muscle Z line, alpha 2 antibody
    • CapZ alpha 2 antibody
    • CapZ alpha-2 antibody
    • CAPZ antibody
    • CAPZA2 antibody
    • CAZA2_HUMAN antibody
    • F actin capping protein alpha 2 subunit antibody
    • F actin capping protein subunit alpha 2 antibody
    • F-actin-capping protein subunit alpha-2 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung cancer tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast cancer tissue labelling CAPZA2 with ab175378 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of HepG2 cells using ab175378. Blue DAPI for nuclear staining.
  • All lanes : Anti-CAPZA2 antibody (ab175378) at 1/500 dilution

    Lane 1 : HeLa lysate
    Lane 2 : THP1 lysate
    Lane 3 : 22RV1 lysate
    Lane 4 : Mouse brain lysate
    Lane 5 : Mouse heart lysate

    Predicted band size: 33 kDa

References

ab175378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up