Anti-Carbon storage regulator antibody (ab225947)

Overview

  • Product name

    Anti-Carbon storage regulator antibody
  • Description

    Rabbit polyclonal to Carbon storage regulator
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Carbon storage regulator aa 1-61.
    Sequence:

    MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQR IQAEKSQQSSY


    Database link: B1XCM4

  • Positive control

    • WB: Recombinant Escherichia coli Carbon storage regulator protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 23 kDa (predicted molecular weight: 23 kDa).

Images

  • All lanes : Anti-Carbon storage regulator antibody (ab225947) at 1/500 dilution

    Lane 1 : Recombinant Escherichia coli Carbon storage regulator protein at 0.08 µg
    Lane 2 : Recombinant Escherichia coli Carbon storage regulator protein at 0.04 µg
    Lane 3 : Recombinant Escherichia coli Carbon storage regulator protein at 0.02 µg
    Lane 4 : Recombinant Escherichia coli Carbon storage regulator protein at 0.01 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 23 kDa
    Observed band size: 23 kDa

References

ab225947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up