Anti-Carbonic Anhydrase 13/CA13 antibody (ab236579)
Key features and details
- Rabbit polyclonal to Carbonic Anhydrase 13/CA13
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Carbonic Anhydrase 13/CA13 antibody
See all Carbonic Anhydrase 13/CA13 primary antibodies -
Description
Rabbit polyclonal to Carbonic Anhydrase 13/CA13 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human Carbonic Anhydrase 13/CA13 aa 1-262.
Sequence:MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSI KYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGS ADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQ IGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLT VPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQ PLKGRKVRASFH
Database link: Q8N1Q1 -
Positive control
- WB: NIH/3T3 cell lysate. IHC-P: Human placenta tissue.
-
General notes
This product was previously labelled as CA13
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236579 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 29 kDa. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Reversible hydration of carbon dioxide. -
Tissue specificity
Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis. -
Sequence similarities
Belongs to the alpha-carbonic anhydrase family.
Contains 1 alpha-carbonic anhydrase domain. - Information by UniProt
-
Database links
- Entrez Gene: 377677 Human
- Entrez Gene: 71934 Mouse
- Omim: 611436 Human
- SwissProt: Q8N1Q1 Human
- SwissProt: Q9D6N1 Mouse
- Unigene: 127189 Human
- Unigene: 158776 Mouse
-
Alternative names
- CA 13 antibody
- CA XIII antibody
- CA-XIII antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 13/CA13 antibody (ab236579)
Paraffin-embedded human placenta tissue stained for Carbonic Anhydrase 13/CA13 using ab236579 at 1/100 dilution in immunohistochemical analysis.
-
Anti-Carbonic Anhydrase 13/CA13 antibody (ab236579) at 1/500 dilution + NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 29 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236579 has not yet been referenced specifically in any publications.