Overview

  • Product name

    Anti-Carbonic Anhydrase 13/CA13 antibody
    See all Carbonic Anhydrase 13/CA13 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 13/CA13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Carbonic Anhydrase 13/CA13 aa 1-262.
    Sequence:

    MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSI KYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGS ADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQ IGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLT VPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQ PLKGRKVRASFH


    Database link: Q8N1Q1

  • Positive control

    • WB: NIH/3T3 cell lysate. IHC-P: Human placenta tissue.
  • General notes

     This product was previously labelled as CA13

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
    Contains 1 alpha-carbonic anhydrase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • CA 13 antibody
    • CA XIII antibody
    • CA-XIII antibody
    • CA13 antibody
    • CA13 carbonic anhydrase XIII antibody
    • CAH13_HUMAN antibody
    • Carbonate dehydratase XIII antibody
    • Carbonic anhydrase 13 antibody
    • Carbonic anhydrase XIII antibody
    • CAXIII antibody
    • EC=4.2.1.1 antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for Carbonic Anhydrase 13/CA13 using ab236579 at 1/100 dilution in immunohistochemical analysis.

  • Anti-Carbonic Anhydrase 13/CA13 antibody (ab236579) at 1/500 dilution + NIH/3T3 (mouse embryo fibroblast cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 29 kDa

References

ab236579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up