Overview

  • Product name

    Anti-Carbonic Anhydrase 14/CA14 antibody
    See all Carbonic Anhydrase 14/CA14 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 14/CA14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Carbonic Anhydrase 14/CA14 aa 16-290. Extracellular domain
    Sequence:

    ADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQ PHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQK GSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIE VGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGS LTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRA LQPLNQRMVFASFIQAGSSYTTGEM


    Database link: Q9ULX7

  • Positive control

    • IHC-P: Human breast cancer and skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CA 14 antibody
    • CA XIV antibody
    • CA-XIV antibody
    • CA14 antibody
    • CAH14_HUMAN antibody
    • Carbonate dehydratase XIV antibody
    • Carbonic anhydrase 14 antibody
    • Carbonic anhydrase XIV antibody
    • Carbonic dehydratase antibody
    • CAXIV antibody
    • UNQ690/PRO1335 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Carbonic Anhydrase 14/CA14 using ab238767 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained forCarbonic Anhydrase 14/CA14 using ab238767 at 1/100 dilution in immunohistochemical analysis.

References

ab238767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up