Overview

  • Product name

    Anti-Carbonic Anhydrase 3/CA3 antibody
    See all Carbonic Anhydrase 3/CA3 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 3/CA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Horse, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Carbonic Anhydrase 3/CA3 aa 1-260.
    Sequence:

    MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFK


    Database link: P07451

  • Positive control

    • Recombinant Human Carbonic Anhydrase 3/CA3 protein (BSA and azide free) (ab173078) can be used as a positive control in WB. HeLa and 293 cell lysate.
  • General notes

     This product was previously labelled as Carbonic Anhydrase III

     

Properties

Applications

Our Abpromise guarantee covers the use of ab175309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 30 kDa.

Target

Images

  • All lanes : Anti-Carbonic Anhydrase 3/CA3 antibody (ab175309) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 293 cell lysate

    Predicted band size: 30 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase 3/CA3 with ab175309 at 1/200. Magnification: 200x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling Carbonic Anhydrase 3/CA3 with ab175309 at 1/200. Magnification: 400x.

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175309. Blue DAPI for nuclear staining.

References

ab175309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up