Overview

  • Product name

    Anti-Carbonic Anhydrase 3/CA3 antibody
    See all Carbonic Anhydrase 3/CA3 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 3/CA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Horse, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Carbonic Anhydrase 3/CA3 aa 1-260.
    Sequence:

    MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVS YDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSS DDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIG HENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTP PCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPI NNRVVRASFK


    Database link: P07451

  • Positive control

    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. Mouse kidney, lung and skeletal muscle extracts; Rat testis tissue; HeLa cells.
  • General notes

     This product was previously labelled as Carbonic Anhydrase III

     

Properties

Applications

Our Abpromise guarantee covers the use of ab196835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 30 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-Carbonic Anhydrase 3/CA3 antibody (ab196835) at 1/500 dilution

    Lane 1 : Mouse kidney extract
    Lane 2 : Mouse lung extract
    Lane 3 : Mouse skeletal muscle extract

    Predicted band size: 30 kDa

  • Immunohistochemical analysis of paraffin-embedded Rat testis tissue labeling Carbonic Anhydrase 3/CA3 with ab196835 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Rat testis tissue labeling Carbonic Anhydrase 3/CA3 with ab196835 at 1/200 dilution.

  • Immunofluorescent analysis of HeLa cells labeling Carbonic Anhydrase III/CA3 with ab196835 at 1/50 dilution. Blue: DAPI for nuclear staining.

References

ab196835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up