Overview

  • Product name

    Anti-Carbonic Anhydrase 3/CA3 antibody [C2]
    See all Carbonic Anhydrase 3/CA3 primary antibodies
  • Description

    Mouse monoclonal [C2] to Carbonic Anhydrase 3/CA3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Carbonic Anhydrase 3/CA3 aa 2-260. N-terminal His Tag (Expressed in E.coli).
    Sequence:

    AKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSY DGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSD DHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGH ENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPP CEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPIN NRVVRASFK


    Database link: P07451

  • Positive control

    • WB: Recombinant human Carbonic Anhydrase 3/CA3 protein; Pig and rat skeletal muscle lysate; human liver and lung lysates.
  • General notes

     This product was previously labelled as Carbonic Anhydrase III

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 30 kDa.

Target

  • Function

    Reversible hydration of carbon dioxide.
  • Tissue specificity

    Muscle specific.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Developmental stage

    At 6 weeks gestation, transcripts accumulate at low levels in the somites and at high levels throughout the notochord. As gestation continues, CA3 becomes abundant in all developing muscle masses and continues at high to moderate levels in the notochord.
  • Post-translational
    modifications

    S-glutathionylated in hepatocytes under oxidative stress.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CA III antibody
    • CA-III antibody
    • Ca3 antibody
    • CAH3_HUMAN antibody
    • CAIII antibody
    • Car3 antibody
    • Carbonate dehydratase III antibody
    • Carbonic anhydrase 3 antibody
    • Carbonic anhydrase III antibody
    • Carbonic anhydrase III muscle specific antibody
    • EC 4.2.1.1 antibody
    • Epididymis secretory sperm binding protein Li 167mP antibody
    • HEL S 167mP antibody
    see all

Images

  • Anti-Carbonic Anhydrase 3/CA3 antibody [C2] (ab239504) at 5 µg/ml + Recombinant human Carbonic Anhydrase 3/CA3 protein

    Predicted band size: 30 kDa

  • All lanes : Anti-Carbonic Anhydrase 3/CA3 antibody [C2] (ab239504) at 3 µg/ml

    Lane 1 : Pig skeletal muscle lysate
    Lane 2 : Rat skeletal muscle lysate
    Lane 3 : Human liver lysate
    Lane 4 : Human lung lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG

    Predicted band size: 30 kDa

References

ab239504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up