Overview

  • Product name

    Anti-Carbonic Anhydrase 4/CA4 antibody
    See all Carbonic Anhydrase 4/CA4 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 4/CA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human Carbonic Anhydrase 4/CA4 aa 19-284. The exact sequence is proprietary. (With tag; BC057792).
    Sequence:

    AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLG RFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHW SDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAF LVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKD NVRPLQQLGQRTVIKS


    Database link: P22748

  • General notes

     This product was previously labelled as Carbonic Anhydrase IV

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 35 kDa.

Target

Images

  • Anti-Carbonic Anhydrase 4/CA4 antibody (ab182608) at 1/500 dilution + Human fetal lung tissue at 30 µg

    Secondary
    Donkey anti Rabbit IgG - H&L (HRP) at 1/3000 dilution

    Predicted band size: 35 kDa


    Exposure time: 40 seconds


    Gel: 10% SDS-PAGE

References

ab182608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up