Overview

  • Product name

    Anti-Carbonic Anhydrase 4/CA4 antibody [C1]
    See all Carbonic Anhydrase 4/CA4 primary antibodies
  • Description

    Mouse monoclonal [C1] to Carbonic Anhydrase 4/CA4
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Carbonic Anhydrase 4/CA4 aa 20-220. Two N-terminal tags, His-tag and T7-tag (Expressed in E.coli).
    Sequence:

    SHWCYEIQAKEPNSHCSGPEQWTGDCKKNQQSPINIVTSKTKLNPSLTPF TFVGYDQKKKWEVKNNQHSVEMSLGEDIYIFGGDLPTQYKAIQLHLHWSE ESNKGSEHSIDGKHFAMEMHVVHKKMTTGDKVQDSDSKDKIAVLAFMVEV GNEVNEGFQPLVEALSRLSKPFTNSTVSESCLQDMLPEKKKLSAYFRYQG S


    Database link: P48284

  • Positive control

    • IHC-P: Rat skeletal muscle tissue. WB: Rat lung and brain lysates; Recombinant rat Carbonic Anhydrase IV/CA4 protein.
  • General notes

     This product was previously labelled as Carbonic Anhydrase IV

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C1
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 mg/ml. Predicted molecular weight: 35 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • CA IV antibody
    • CA4 antibody
    • CAH4_HUMAN antibody
    • CAIV antibody
    • Car4 antibody
    • Carbonate dehydratase IV antibody
    • Carbonic anhydrase 4 antibody
    • Carbonic dehydratase antibody
    • Carbonic dehydratase IV antibody
    • EC 4.2.1.1 antibody
    • Retinitis pigmentosa 17 (autosomal dominant) antibody
    • RP17 antibody
    see all

Images

  • Paraffin-embedded rat skeletal muscle tissue stained for Carbonic Anhydrase 4/CA4 using ab239505 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Carbonic Anhydrase 4/CA4 antibody [C1] (ab239505) at 2 µg/ml

    Lane 1 : Rat lung lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 35 kDa

  • Anti-Carbonic Anhydrase 4/CA4 antibody [C1] (ab239505) at 2 µg/ml + Recombinant rat Carbonic Anhydrase IV/CA4 protein

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 35 kDa

References

ab239505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up