Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)
Key features and details
- Rabbit polyclonal to Carbonic Anhydrase 5A/CA5A
- Suitable for: WB, IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-Carbonic Anhydrase 5A/CA5A antibody -
Description
Rabbit polyclonal to Carbonic Anhydrase 5A/CA5A -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat Carbonic Anhydrase 5A/CA5A aa 12-219. Expressed in E.coli. N-terminal tag.
Sequence:YKPLAILRHMGPLCATRPQHWRFQHSYAEKHSNCARHPLWTGPVSSPGGT QQSPINIQWTDSVYDPKLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEE SGISGGPLGNHYRLKQFHFHWGATDEWGSEHMVDGHAYPAELHLVHWNSM KYENYKKATTGENGLAVIGVFLKLGAHHEALQRLVDILPEVRHKDTQVTM GPFDPSCL
Database link: P43165 -
Positive control
- WB: Recombinant rat Carbonic Anhydrase 5A/CA5A protein; rat serum; rat heart, lung and spleen lysates. IHC-P: Rat liver tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab231676 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Relevance
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA5A is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. -
Cellular localization
Mitochondrial -
Database links
- Entrez Gene: 54233 Rat
- SwissProt: P43165 Rat
-
Alternative names
- CA VA antibody
- CA5 antibody
- Carbonate dehydratase VA antibody
see all
Images
-
All lanes : Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676) at 1.5 µg/ml
Lane 1 : Rat serum
Lane 2 : Rat heart lysate
Lane 3 : Rat lung lysate
Lane 4 : Rat spleen lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)
Formalin-fixed, paraffin-embedded rat liver tissue stained for Carbonic Anhydrase 5A/CA5A using ab231676 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676) at 1.5 µg/ml + Recombinant rat Carbonic Anhydrase 5A/CA5A protein
Secondary
HRP-Linked Guinea pig anti-Rabbit
Predicted band size: 35 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231676 has not yet been referenced specifically in any publications.