Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Carbonic Anhydrase 5A/CA5A antibody -
Description
Rabbit polyclonal to Carbonic Anhydrase 5A/CA5A -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant fragment (His-tag) corresponding to Rat Carbonic Anhydrase 5A/CA5A aa 12-219. Expressed in E.coli. N-terminal tag.
Sequence:YKPLAILRHMGPLCATRPQHWRFQHSYAEKHSNCARHPLWTGPVSSPGGT QQSPINIQWTDSVYDPKLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEE SGISGGPLGNHYRLKQFHFHWGATDEWGSEHMVDGHAYPAELHLVHWNSM KYENYKKATTGENGLAVIGVFLKLGAHHEALQRLVDILPEVRHKDTQVTM GPFDPSCL
Database link: P43165 -
Positive control
- WB: Recombinant rat Carbonic Anhydrase 5A/CA5A protein; rat serum; rat heart, lung and spleen lysates. IHC-P: Rat liver tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab231676 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Relevance
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA5A is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. -
Cellular localization
Mitochondrial -
Database links
- Entrez Gene: 54233 Rat
- SwissProt: P43165 Rat
-
Alternative names
- CA VA antibody
- CA5 antibody
- Carbonate dehydratase VA antibody
see all
Images
-
Western blot - Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)All lanes : Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676) at 1.5 µg/ml
Lane 1 : Rat serum
Lane 2 : Rat heart lysate
Lane 3 : Rat lung lysate
Lane 4 : Rat spleen lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)Formalin-fixed, paraffin-embedded rat liver tissue stained for Carbonic Anhydrase 5A/CA5A using ab231676 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676)Anti-Carbonic Anhydrase 5A/CA5A antibody (ab231676) at 1.5 µg/ml + Recombinant rat Carbonic Anhydrase 5A/CA5A protein
Secondary
HRP-Linked Guinea pig anti-Rabbit
Predicted band size: 35 kDa
Datasheets and documents
References
ab231676 has not yet been referenced specifically in any publications.
