Overview

  • Product name

    Anti-Carbonic Anhydrase 5B/CA5B antibody
    See all Carbonic Anhydrase 5B/CA5B primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 5B/CA5B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Carbonic Anhydrase 5B/CA5B aa 63-225. (Expressed in E.coli).
    Sequence:

    RQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDSTDK SVVEGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAV KFESFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDTLVEF GSFDPSCLMPTCP


    Database link: Q9QZA0

  • Positive control

    • IHC-P: Mouse ovary, cerebrum, uterus, testis, liver and kidney tissues. WB: Mouse liver lysate; Recombinant mouse CA5B/CA-VB protein.
  • General notes

     This product was previously labelled as CA5B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

Images

  • Paraffin-embedded mouse ovary tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse cerebrum tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse uterus tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse liver tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for Carbonic Anhydrase 5B/CA5B using ab231663 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Carbonic Anhydrase 5B/CA5B antibody (ab231663) at 2 µg/ml + Recombinant mouse Carbonic Anhydrase 5B/CA5B protein

    Predicted band size: 37 kDa

  • Anti-Carbonic Anhydrase 5B/CA5B antibody (ab231663) at 1.5 µg/ml + Mouse liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 37 kDa

  • Anti-Carbonic Anhydrase 5B/CA5B antibody (ab231663) at 1.5 µg/ml + Mouse liver lysate

    Predicted band size: 37 kDa

References

ab231663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up