Overview

  • Product name

    Anti-Carbonic Anhydrase 6/CA6 antibody
    See all Carbonic Anhydrase 6/CA6 primary antibodies
  • Description

    Rabbit polyclonal to Carbonic Anhydrase 6/CA6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Carbonic Anhydrase 6/CA6 aa 147-275. (Expressed in E.coli).
    Sequence:

    TYEKAVDQPDGLAVMAVLVKVEDYTENDYYSTFISELENVKYTGQTTTLR NVNIRNMLPGDIRHYYTYQGSLTTPPCTENVKWFVFQDSATISKAQAERI ENAVMDHHNQTIRNGYRRTQPLHNRVVEA


    Database link: F1LQ08

  • Positive control

    • WB: Rat salivary gland lysate; Recombinant rat Carbonic Anhydrase 6/CA6 protein.
  • General notes

    Previously labelled as CA6.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231045 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 36 kDa.

Target

  • Function

    Reversible hydration of carbon dioxide. Its role in saliva is unknown.
  • Tissue specificity

    Major constituent of saliva.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CA VI antibody
    • CA-VI antibody
    • CA6 antibody
    • CAH6_HUMAN antibody
    • Carbonate dehydratase VI antibody
    • Carbonic anhydrase 6 antibody
    • Carbonic anhydrase VI antibody
    • carbonic anhydrase VI nirs variant 1 antibody
    • carbonic anhydrase VI nirs variant 3 antibody
    • GUSTIN antibody
    • MGC21256 antibody
    • Salivary carbonic anhydrase antibody
    • Secreted carbonic anhydrase antibody
    see all

Images

  • Anti-Carbonic Anhydrase 6/CA6 antibody (ab231045) at 2 µg/ml + Rat salivary gland lysate

    Predicted band size: 36 kDa

  • Anti-Carbonic Anhydrase 6/CA6 antibody (ab231045) at 2 µg/ml + Recombinant rat CA-VI protein

    Predicted band size: 36 kDa

References

ab231045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up