Overview

  • Product name

    Anti-Carboxylesterase 1C antibody
    See all Carboxylesterase 1C primary antibodies
  • Description

    Rabbit polyclonal to Carboxylesterase 1C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse Carboxylesterase 1C aa 19-550.
    Sequence:

    HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPP QPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLY LNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTI QYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIF GESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIA TLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPK APEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLL LRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAV LLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLL KEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGA TTQQAQRLKAEEVAFWTELLAKNPPETDPTEH


    Database link: P23953

  • Positive control

    • WB: Mouse liver, mouse lung, mouse kidney, mouse skeletal muscle, mouse thymus and rat liver tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 61 kDa (predicted molecular weight: 61 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
  • Tissue specificity

    Expressed in lung, kidney and liver.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Endoplasmic reticulum lumen. Microsomal membrane, lumen of endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxylesterase 1C antibody
    • Ces N antibody
    • Ces1c antibody
    • Ee 1 antibody
    • Ee 4 antibody
    • Ee1 antibody
    • Es N antibody
    • Es1 antibody
    • Es4 antibody
    • EsN antibody
    • EST1C_MOUSE antibody
    • Esterase 1 antibody
    • Liver carboxylesterase N antibody
    • Lung surfactant convertase antibody
    • PES-N antibody
    • PESN antibody
    see all

Images

  • All lanes : Anti-Carboxylesterase 1C antibody (ab193485) at 2 µg

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Rat liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

  • All lanes : Anti-Carboxylesterase 1C antibody (ab193485) at 4 µg/ml

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Mouse kidney tissue lysate
    Lane 3 : Mouse skeletal muscle tissue lysate
    Lane 4 : Mouse thymus tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

References

This product has been referenced in:

  • Chen Y  et al. Transcriptomic and proteomic analysis of potential therapeutic target genes in the liver of metformin-treated Sprague-Dawley rats with type 2 diabetes mellitus. Int J Mol Med 41:3327-3341 (2018). Read more (PubMed: 29512687) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up