Overview

  • Product name

    Anti-Carboxypeptidase A antibody [CL6629]
    See all Carboxypeptidase A primary antibodies
  • Description

    Mouse monoclonal [CL6629] to Carboxypeptidase A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human Carboxypeptidase A aa 19-88.
    Sequence:

    DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVP FPSIQAVKIFLESHGISYET


    Database link: P15085

  • Positive control

    • WB: Human pancreas tissue lysate. IHC-P: Human panceas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • carboxypeptidase A1 (pancreatic) antibody
    • Carboxypeptidase A1 antibody
    • Carboxypeptidase A1 precursor antibody
    • CBPA1_HUMAN antibody
    • CPA antibody
    • CPA1 antibody
    • Pancreatic carboxypeptidase A1 antibody
    • Procarboxypeptidase A1 pancreatic antibody
    see all

Images

  • Anti-Carboxypeptidase A antibody [CL6629] (ab243039) at 1 µg + Human pancreas tissue lysate

    Predicted band size: 47 kDa

  • Paraffin-embedded human panceas tissue stained for Carboxypeptidase A with ab243039 at 1/5000 dilution in immunohistochemical analysis.

  • Negative control:

    Paraffin-embedded human tonsil tissue stained for Carboxypeptidase A with ab243039 at 1/5000 dilution in immunohistochemical analysis.

References

ab243039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up