Overview

  • Product name

    Anti-Carboxypeptidase B/CPB antibody
    See all Carboxypeptidase B/CPB primary antibodies
  • Description

    Rabbit polyclonal to Carboxypeptidase B/CPB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Carboxypeptidase B/CPB aa 109-415. (Expressed in E.coli).
    Sequence:

    ASGHSYTKYNNWETIEAWIQQVANDNPDLVSKRVIGTTFEGRNMYVLKIG KDRPNKPAFFIDCGFHAREWISPAFCQWFVREAVRTYKQEIHMKRLLDEL DFYVLPVVNIDGYVYTWAKDRMWRKTRSTTAGSSCFGVDPNRNFDAGWCE VGASRSPCSDTYCGPTPESEKETKALADFIRQNLSSIKAYLTVHSYSQMM LYPYSYDYKLPENYEELNALVKGAAKELSTLHGTKYTYGPGATTIYPAAG GSDDWAYDQGIKYSFTFELRDKGFFGFLLPESQIRQTCEETMLAVKYIAN YVLEHPY


    Database link: B2RS76

  • Positive control

    • WB: Recombinant mouse Carboxypeptidase B/CPB; Mouse pancreas and spleen lysates; Rat pancreas lysate. IHC-P: Mouse pancreas, kidney, testis, uterus and oviduct tissues.
  • General notes

     This product was previously labelled as Carboxypeptidase B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231536 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 48 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Pancreas.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxypeptidase B antibody
    • Carboxypeptidase B1 (tissue) antibody
    • Carboxypeptidase B1 antibody
    • CarboxypeptidaseB antibody
    • CarboxypeptidaseB1 antibody
    • CBPB1_HUMAN antibody
    • CP B1 antibody
    • CPB 1 antibody
    • CPB antibody
    • CPB1 antibody
    • DKFZp779K1333 antibody
    • Pancreas specific protein antibody
    • Pancreas-specific protein antibody
    • Pancreatic carboxypeptidase B antibody
    • Pancreatic carboxypeptidase B1 antibody
    • PASP antibody
    • PCPB antibody
    • Procarboxypeptidase B antibody
    • Procarboxypeptidase B pancreatic antibody
    • Protaminase antibody
    • Tissue carboxypeptidase B antibody
    see all

Images

  • Anti-Carboxypeptidase B/CPB antibody (ab231536) at 2 µg/ml + Recombinant mouse Carboxypeptidase B/CPB

    Predicted band size: 48 kDa

  • Anti-Carboxypeptidase B/CPB antibody (ab231536) at 2 µg/ml + Mouse pancreas lysate

    Predicted band size: 48 kDa

  • Anti-Carboxypeptidase B/CPB antibody (ab231536) at 2 µg/ml + Mouse spleen lysate

    Predicted band size: 48 kDa

  • Anti-Carboxypeptidase B/CPB antibody (ab231536) at 2 µg/ml + Rat pancreas lysate

    Predicted band size: 48 kDa

  • Paraffin-embedded mouse pancreas tissue stained for Carboxypeptidase B/CPB using ab231536 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Carboxypeptidase B/CPB using ab231536 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse uterus tissue stained for Carboxypeptidase B/CPB using ab231536 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for Carboxypeptidase B/CPB using ab231536 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse oviduct tissue stained for Carboxypeptidase B/CPB using ab231536 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up