Overview

  • Product name

    Anti-Carboxypeptidase B/CPB antibody (Biotin)
    See all Carboxypeptidase B/CPB primary antibodies
  • Description

    Rabbit polyclonal to Carboxypeptidase B/CPB (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Cow, Dog
  • Immunogen

    Full length native protein (purified) corresponding to Pig Carboxypeptidase B/CPB aa 111-416. (Derived from Porcine pancreas).
    Sequence:

    TTGHSYEKYNNWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVG KPGPNKPAIFMDCGFHAREWISHAFCQWFVREAVLTYGYESHMTEFLNKL DFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGTTCIGTDPNRNFDAGWCT TGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMI LYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTN YVLGHL


    Database link: P09955

  • General notes

     This product was previously labelled as Carboxypeptidase B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.20
    Preservative: 0.01% Sodium azide
    Constituents: 1% BSA, 0.42% Potassium phosphate, 0.87% Sodium chloride

    BSA is Immunoglobulin and Protease free.
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    ab191359 is an IgG fraction antibody purified by a multi-step process including delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against buffer.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
ELISA
  • Application notes
    Dot: Use at an assay dependent dilution.
    ELISA: 1/4000 - 1/20000.
    This antibody has been assayed against 1.0µg of Carboxypeptidase B in a standard capture ELISA using Peroxidase conjugated streptavidin and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at RT.
    IM: Use at an assay dependent dilution.
    WB: Use at an assay dependent dilution. Predicted molecular weight: 46 kDa.
    Suitable for other antibody based assays using streptavidin or avidin conjugates.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Tissue specificity

      Pancreas.
    • Sequence similarities

      Belongs to the peptidase M14 family.
    • Cellular localization

      Secreted.
    • Information by UniProt
    • Database links

    • Alternative names

      • Carboxypeptidase B antibody
      • Carboxypeptidase B1 (tissue) antibody
      • Carboxypeptidase B1 antibody
      • CarboxypeptidaseB antibody
      • CarboxypeptidaseB1 antibody
      • CBPB1_HUMAN antibody
      • CP B1 antibody
      • CPB 1 antibody
      • CPB antibody
      • CPB1 antibody
      • DKFZp779K1333 antibody
      • Pancreas specific protein antibody
      • Pancreas-specific protein antibody
      • Pancreatic carboxypeptidase B antibody
      • Pancreatic carboxypeptidase B1 antibody
      • PASP antibody
      • PCPB antibody
      • Procarboxypeptidase B antibody
      • Procarboxypeptidase B pancreatic antibody
      • Protaminase antibody
      • Tissue carboxypeptidase B antibody
      see all

    References

    ab191359 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab191359.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up