Overview

  • Product name
    Anti-Carcino Embryonic Antigen CEA antibody
    See all Carcino Embryonic Antigen CEA primary antibodies
  • Description
    Rabbit polyclonal to Carcino Embryonic Antigen CEA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Carcino Embryonic Antigen CEA aa 1-702.
    Sequence:

    MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKE VLLLVHNLPQ HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGR EIIYPNASLLIQNIIQNDTGFY TLHVIKSDLVNEEATGQFRVYPELPK PSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV NNQSLPVSPRLQLS NGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP TI SPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVN NSGSYTCQ AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDA VALTCEPEIQNTTYLWWVNN QSLPVSPRLQLSNDNRTLTLLSVTRNDV GPYECGIQNKLSVDHSDPVILNVLYGPDDPTI SPSYTYYRPGVNLSLS CHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN NSAS GHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLW WVNGQS LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRS DPVTLDVLYGPDTPIISP PDSSYLSGANLNLSCHSASNPSPQYSWRIN GIPQQHTQVLFIAKITPNNNGTYACFVSNL ATGRNNSIVKSITVSASG TSPGLSAGATVGIMIGVLVGVALI


    Database link: P06731

  • Positive control
    • HeLa, HepG2, HT-29, MCF-7 and A549 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab175311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 76 kDa.

Target

  • Function
    Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins.
  • Tissue specificity
    Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 7 Ig-like (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Complex immunoreactive glycoprotein with a MW of 180 kDa comprising 60% carbohydrate.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Carcinoembryonic antigen antibody
    • Carcinoembryonic antigen-related cell adhesion molecule 5 antibody
    • CD66e antibody
    • CEA antibody
    • Ceacam5 antibody
    • CEAM5_HUMAN antibody
    • DKFZp781M2392 antibody
    • Meconium antigen 100 antibody
    • OTTHUMP00000199032 antibody
    • OTTHUMP00000199033 antibody
    • OTTHUMP00000199034 antibody
    see all

Images

  • All lanes : Anti-Carcino Embryonic Antigen CEA antibody (ab175311) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : HT29 cell lysate
    Lane 4 : MCF-7 cell lysate
    Lane 5 : A549 cell lysate

    Predicted band size: 76 kDa

References

ab175311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up