Overview

  • Product name

    Anti-CARD8 antibody - N-terminal
    See all CARD8 primary antibodies
  • Description

    Rabbit polyclonal to CARD8 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CARD8 aa 1-200 (N terminal).
    Sequence:

    MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEED YKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFLVRDEV TVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAVAEIHLPHFIS LQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIA


    Database link: Q9Y2G2

  • Positive control

    • Extracts from K562, A673 and ES2 cell lines.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 49 kDa.

Target

  • Function

    Inhibits NF-kappa-B activation. May participate in a regulatory mechanism that coordinates cellular responses controlled by NF-kappa-B transcription factor. May be a component of the inflammasome, a protein complex which also includes PYCARD, NALP2 and CASP1 and whose function would be the activation of proinflammatory caspases.
  • Tissue specificity

    High expression in lung, ovary, testis and placenta. Lower expression in heart, kidney and liver. Also expressed in spleen, lymph node and bone marrow.
  • Sequence similarities

    Contains 1 CARD domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptotic protein NDPP 1 antibody
    • Apoptotic protein NDPP1 antibody
    • CARD 8 antibody
    • CARD inhibitor of NF kappa B activating ligand antibody
    • CARD inhibitor of NF kappaB activating ligand antibody
    • CARD inhibitor of NF kappaB activating ligands antibody
    • CARD-inhibitor of NF-kappa-B-activating ligand antibody
    • CARD8 antibody
    • CARD8_HUMAN antibody
    • CARDINAL antibody
    • Caspase recruitment domain containing protein 8 antibody
    • Caspase recruitment domain family member 8 antibody
    • Caspase recruitment domain protein 8 antibody
    • Caspase recruitment domain-containing protein 8 antibody
    • DACAR antibody
    • Dakar antibody
    • DKFZp779L0366 antibody
    • FLJ18119 antibody
    • FLJ18121 antibody
    • KIAA0955 antibody
    • MGC57162 antibody
    • NDPP 1 antibody
    • NDPP antibody
    • NDPP1 antibody
    • TUCAN antibody
    • Tumor up regulated CARD containing antagonist of CASP9 antibody
    • Tumor up regulated CARD containing antagonist of caspase 9 antibody
    • Tumor up-regulated CARD-containing antagonist of CASP9 antibody
    • tumor up-regulated CARD-containing antagonist of caspase nine antibody
    • Tumor upregulated CARD containing antagonist of CASP9 antibody
    see all

Images

  • All lanes : Anti-CARD8 antibody - N-terminal (ab194585) at 1/500 dilution

    Lane 1 : Extracts from K562 cell line
    Lane 2 : Extracts from A673 cell line
    Lane 3 : Extracts from ES2 cell line

    Predicted band size: 49 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up