Overview

  • Product name
    Anti-Cardiac Troponin I antibody
    See all Cardiac Troponin I primary antibodies
  • Description
    Rabbit polyclonal to Cardiac Troponin I
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Pig
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Cardiac Troponin I aa 1-203. (Expressed in E.coli).
    Sequence:

    MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLK TLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQL HARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRIS ADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSG MEG


    Database link: P19429

  • Positive control
    • WB: Mouse heart and skeletal muscle lysates; Pig heart and skeletal muscle lysates; Recombinant human Cardiac Troponin I protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function
    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Involvement in disease
    Defects in TNNI3 are the cause of cardiomyopathy familial hypertrophic type 7 (CMH7) [MIM:613690]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TNNI3 are the cause of cardiomyopathy familial restrictive type 1 (RCM1) [MIM:115210]. RCM1 is an heart muscle disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 2A (CMD2A) [MIM:611880]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 1FF (CMD1FF) [MIM:613286]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities
    Belongs to the troponin I family.
  • Information by UniProt
  • Database links
  • Alternative names
    • cardiac muscle antibody
    • Cardiac troponin I antibody
    • cardiomyopathy, dilated 2A (autosomal recessive) antibody
    • Cardiomyopathy, familial hypertrophic, 7, included antibody
    • CMD1FF antibody
    • CMD2A antibody
    • CMH7 antibody
    • cTnI antibody
    • Familial hypertrophic cardiomyopathy 7 antibody
    • MGC116817 antibody
    • RCM1 antibody
    • Tn1 antibody
    • Tni antibody
    • TNN I3 antibody
    • TNNC 1 antibody
    • TNNC1 antibody
    • TNNI3 antibody
    • TNNI3_HUMAN antibody
    • Troponin I antibody
    • Troponin I cardiac antibody
    • Troponin I cardiac muscle antibody
    • Troponin I cardiac muscle isoform antibody
    • Troponin I type 3 cardiac antibody
    • troponin I, cardiac 3 antibody
    • TroponinI antibody
    • Ttroponin I type 3 (cardiac) antibody
    see all

Images

  • All lanes : Anti-Cardiac Troponin I antibody (ab231679) at 2 µg/ml

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse skeletal muscle lysate
    Lane 3 : Pig heart lysate
    Lane 4 : Pig skeletal muscle lysate

    Predicted band size: 24 kDa

  • Anti-Cardiac Troponin I antibody (ab231679) at 2 µg/ml + Recombinant human Cardiac Troponin I protein

    Predicted band size: 24 kDa

References

ab231679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up