Overview

  • Product name

    Anti-Cardiac Troponin I antibody
    See all Cardiac Troponin I primary antibodies
  • Description

    Rabbit polyclonal to Cardiac Troponin I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Human
  • Immunogen

    Recombinant full length protein corresponding to Mouse Cardiac Troponin I aa 2-211.
    Sequence:

    MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQL KTLMLQIAKQEMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQ LHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRI SADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALS GMEGRKKKFEG


    Database link: P48787

  • Positive control

    • WB: Rat heart and liver tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab234685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 25 kDa (predicted molecular weight: 24 kDa).

Target

  • Function

    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Involvement in disease

    Defects in TNNI3 are the cause of cardiomyopathy familial hypertrophic type 7 (CMH7) [MIM:613690]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TNNI3 are the cause of cardiomyopathy familial restrictive type 1 (RCM1) [MIM:115210]. RCM1 is an heart muscle disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 2A (CMD2A) [MIM:611880]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 1FF (CMD1FF) [MIM:613286]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities

    Belongs to the troponin I family.
  • Information by UniProt
  • Database links

  • Alternative names

    • cardiac muscle antibody
    • Cardiac troponin I antibody
    • cardiomyopathy, dilated 2A (autosomal recessive) antibody
    • Cardiomyopathy, familial hypertrophic, 7, included antibody
    • CMD1FF antibody
    • CMD2A antibody
    • CMH7 antibody
    • cTnI antibody
    • Familial hypertrophic cardiomyopathy 7 antibody
    • MGC116817 antibody
    • RCM1 antibody
    • Tn1 antibody
    • Tni antibody
    • TNN I3 antibody
    • TNNC 1 antibody
    • TNNC1 antibody
    • TNNI3 antibody
    • TNNI3_HUMAN antibody
    • Troponin I antibody
    • Troponin I cardiac antibody
    • Troponin I cardiac muscle antibody
    • Troponin I cardiac muscle isoform antibody
    • Troponin I type 3 cardiac antibody
    • troponin I, cardiac 3 antibody
    • TroponinI antibody
    • Ttroponin I type 3 (cardiac) antibody
    see all

Images

  • All lanes : Anti-Cardiac Troponin I antibody (ab234685) at 1/500 dilution

    Lane 1 : Rat heart tissue lysate
    Lane 2 : Rat liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 24 kDa
    Observed band size: 25 kDa
    why is the actual band size different from the predicted?

References

ab234685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up