Overview

  • Product name

  • Description

    Rabbit polyclonal to CARS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chicken, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CARS aa 201-500.
    Sequence:

    TLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVN FVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEG EGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHL TIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTME SALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTA


    Database link: P49589

  • Positive control

    • WB: PC-3 whole cell lysate. Mouse lung and kidney tissue lysate. IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000.

Target

  • Involvement in disease

    Note=A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cysteine tRNA ligase antibody
    • Cars antibody
    • CysRS antibody
    • Cysteine--tRNA ligase antibody
    • Cysteinyl tRNA synthetase, cytoplasmic antibody
    • Cysteinyl-tRNA synthetase antibody
    • cytoplasmic antibody
    • MGC:11246 antibody
    • SYCC_HUMAN antibody
    see all

Images

  • All lanes : Anti-CARS antibody (ab235536) at 1/2000 dilution

    Lane 1 : PC-3 (Human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human pancreas tissue stained for CARS with ab235536 at 1/100 dilution in immunohistochemical analysis.

References

ab235536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up