Overview

  • Product name

    Anti-CARS antibody [CL2302]
    See all CARS primary antibodies
  • Description

    Mouse monoclonal [CL2302] to CARS
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human CARS aa 513-648.
    Sequence:

    SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVG GPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNIL PELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVE


    Database link: A8MVQ3

  • Epitope

    Binds to an epitope located within the peptide sequence RPNQALLENIALYLT as determined by overlapping synthetic peptides.
  • Positive control

    • WB: U-251 MG cell lysate; HeLa cytoplasmic fraction. IHC-P: Human breast cancer, cerebellum, fallopian tube and pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab242361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Involvement in disease

    Note=A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cysteine tRNA ligase antibody
    • Cars antibody
    • CysRS antibody
    • Cysteine--tRNA ligase antibody
    • Cysteinyl tRNA synthetase, cytoplasmic antibody
    • Cysteinyl-tRNA synthetase antibody
    • cytoplasmic antibody
    • MGC:11246 antibody
    • SYCC_HUMAN antibody
    see all

Images

  • Paraffin-embedded human fallopian tube tissue stained for CARS with ab242361 at 1/1000 dilution in immunohistochemical analysis.

  • Anti-CARS antibody [CL2302] (ab242361) at 1 µg/ml + U-251 MG (human brain glioma cell line) cell lysate
  • All lanes : Anti-CARS antibody [CL2302] (ab242361) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cytoplasmic fraction
    Lane 2 : HeLa membrane fraction
    Lane 3 : HeLa nuclear fraction
    Lane 4 : HeLa chromatin fraction
    Lane 5 : HeLa cytoskeletal fraction
  • Paraffin-embedded human breast cancer tissue stained for CARS with ab242361 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebellum tissue stained for CARS with ab242361 at 1/1000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for CARS with ab242361 at 1/1000 dilution in immunohistochemical analysis.

  • Negative control:

    Paraffin-embedded human skeletal muscle tissue stained for CARS with ab242361 at 1/1000 dilution in immunohistochemical analysis.

References

ab242361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up