For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cars-antibody-cl2304-ab242364.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Amino Acids
Share by email

Anti-CARS antibody [CL2304] (ab242364)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
  • Western blot - Anti-CARS antibody [CL2304] (ab242364)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
  • Western blot - Anti-CARS antibody [CL2304] (ab242364)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

Key features and details

  • Mouse monoclonal [CL2304] to CARS
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG2a

You may also be interested in

Protein
Product image
Recombinant Human CARS protein (ab185581)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-CARS antibody [CL2304]
    See all CARS primary antibodies
  • Description

    Mouse monoclonal [CL2304] to CARS
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CARS aa 523-658.
    Sequence:

    SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVG GPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNIL PELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVE


    Database link: P49589
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Epitope

    Binds to an epitope located within the peptide sequence EDSSLGFPVG as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human Placenta, skin, breast cancer, colon and kidney tissue. WB: U-251 MG and HeLa whole cell lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2304
  • Isotype

    IgG2a
  • Research areas

    • Signal Transduction
    • Metabolism
    • Amino Acids
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • Translation
    • tRNA synthetase
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Nucleotide metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HeLa whole cell lysate (ab29545)
  • Recombinant Protein

    • Recombinant Human CARS protein (ab185581)

Applications

Our Abpromise guarantee covers the use of ab242364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa.
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Involvement in disease

    Note=A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession P49589 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 833 Human
    • Omim: 123859 Human
    • SwissProt: P49589 Human
    • Unigene: 274873 Human
    • Alternative names

      • Cysteine tRNA ligase antibody
      • Cars antibody
      • CysRS antibody
      • Cysteine--tRNA ligase antibody
      • Cysteinyl tRNA synthetase, cytoplasmic antibody
      • Cysteinyl-tRNA synthetase antibody
      • cytoplasmic antibody
      • MGC:11246 antibody
      • SYCC_HUMAN antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

      Paraffin-embedded human kidney tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis. 

    • Western blot - Anti-CARS antibody [CL2304] (ab242364)
      Western blot - Anti-CARS antibody [CL2304] (ab242364)
      All lanes : Anti-CARS antibody [CL2304] (ab242364) at 1 µg/ml

      Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate cytoplasmic fraction
      Lane 2 : HeLa membrane fraction
      Lane 3 : HeLa nuclear fraction
      Lane 4 : HeLa chromatin fraction
      Lane 5 : HeLa cytoskeleton fraction

      Predicted band size: 85 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

      Paraffin-embedded human colon tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis. 

    • Western blot - Anti-CARS antibody [CL2304] (ab242364)
      Western blot - Anti-CARS antibody [CL2304] (ab242364)
      Anti-CARS antibody [CL2304] (ab242364) at 1 µg/ml + U-251 MG (human brain glioma cell line) whole cell lysate

      Predicted band size: 85 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

      Paraffin-embedded human breast cancer tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

      Paraffin-embedded human skin tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis. 

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)

      Paraffin-embedded human placenta tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab242364? Please let us know so that we can cite the reference in this datasheet.

    ab242364 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242364.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.