Anti-CARS antibody [CL2304] (ab242364)
Key features and details
- Mouse monoclonal [CL2304] to CARS
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-CARS antibody [CL2304]
See all CARS primary antibodies -
Description
Mouse monoclonal [CL2304] to CARS -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CARS aa 523-658.
Sequence:SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVG GPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNIL PELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVE
Database link: P49589 -
Epitope
Binds to an epitope located within the peptide sequence EDSSLGFPVG as determined by overlapping synthetic peptides. -
Positive control
- IHC-P: Human Placenta, skin, breast cancer, colon and kidney tissue. WB: U-251 MG and HeLa whole cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
CL2304 -
Isotype
IgG2a -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab242364 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa. | |
IHC-P | 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Involvement in disease
Note=A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK. -
Sequence similarities
Belongs to the class-I aminoacyl-tRNA synthetase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 833 Human
- Omim: 123859 Human
- SwissProt: P49589 Human
- Unigene: 274873 Human
-
Alternative names
- Cysteine tRNA ligase antibody
- Cars antibody
- CysRS antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
Paraffin-embedded human kidney tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.
-
All lanes : Anti-CARS antibody [CL2304] (ab242364) at 1 µg/ml
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate cytoplasmic fraction
Lane 2 : HeLa membrane fraction
Lane 3 : HeLa nuclear fraction
Lane 4 : HeLa chromatin fraction
Lane 5 : HeLa cytoskeleton fraction
Predicted band size: 85 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
Paraffin-embedded human colon tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.
-
Anti-CARS antibody [CL2304] (ab242364) at 1 µg/ml + U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 85 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
Paraffin-embedded human breast cancer tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
Paraffin-embedded human skin tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CARS antibody [CL2304] (ab242364)
Paraffin-embedded human placenta tissue stained for CARS using ab242364 at 1/5000 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab242364 has not yet been referenced specifically in any publications.