Anti-CASC4 antibody (ab185097)
Key features and details
- Rabbit polyclonal to CASC4
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CASC4 antibody
See all CASC4 primary antibodies -
Description
Rabbit polyclonal to CASC4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CASC4 aa 301-384 (internal sequence).
Sequence:DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVS DFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG
Database link: Q6P4E1 -
Positive control
- Human colon tissue, U-251MG cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab185097 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the GOLM1/CASC4 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 113201 Human
- SwissProt: Q6P4E1 Human
- Unigene: 512867 Human
-
Alternative names
- Cancer susceptibility candidate 4 antibody
- Cancer susceptibility candidate gene 4 protein antibody
- CASC4 antibody
see all
Images
-
Immunocytochemical analysis of PFA/Triton X-100 fixed U-251MG cells labeling CASC4 with ab185097 at 4 µg/ml
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CASC4 antibody (ab185097)
Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling CASC4 with ab185097 at 1/200 dilution
Protocols
Datasheets and documents
References (0)
ab185097 has not yet been referenced specifically in any publications.