Overview

  • Product name

    Anti-Casein Kinase 1 delta/CSNK1D antibody
    See all Casein Kinase 1 delta/CSNK1D primary antibodies
  • Description

    Rabbit polyclonal to Casein Kinase 1 delta/CSNK1D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human Casein Kinase 1 delta/CSNK1D aa 152-398.
    Sequence:

    LAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGY VLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATY LNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAA DDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSH TANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTS


    Database link: P48730

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human skeletal muscle, liver cancer and lymph node tissue. ICC/IF: HepG2 cells. IP: HeLa whole cell lysate.
  • General notes

    Previously labelled as Casein Kinase 1 delta. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
ICC/IF 1/50 - 1/500.
IHC-P 1/1000 - 1/2000.
WB 1/1000 - 1/5000.

Target

  • Function

    Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. Retains PER1 in the cytoplasm.
  • Tissue specificity

    Expressed in all tissues examined, including brain, heart, lung, liver, pancreas, kidney, placenta and skeletal muscle. In blood, highly expressed in hemopoietic cells and mature granulocytes. Also found in monocytes and lymphocytes.
  • Involvement in disease

    Defects in CSNK1D are a cause of familial advanced sleep-phase syndrome (FASPS) [MIM:604348]. FASPS is characterized by very early sleep onset and offset. Individuals are 'morning larks' with a 4 hours advance of the sleep, temperature and melatonin rhythms.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated on serine and threonine residues.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Casein Kinase 1 delta antibody
    • Casein kinase I delta isoform antibody
    • Casein kinase I isoform delta antibody
    • CKI delta antibody
    • CKI-delta antibody
    • CKId antibody
    • CKIdelta antibody
    • CSNK 1D antibody
    • CSNK1D antibody
    • HCKID antibody
    • KC1D_HUMAN antibody
    • Protein kinase CK1 delta antibody
    see all

Images

  • Anti-Casein Kinase 1 delta/CSNK1D antibody (ab236601) at 1/1000 dilution + HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human skeletal muscle tissue stained for Casein Kinase 1 delta/CSNK1D with ab236601 at a 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Casein Kinase 1 delta/CSNK1D using ab236601 at a dilution of 1/333 in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Casein Kinase 1 delta/CSNK1D was immunoprecipitated from HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate using 6 µg of ab236601.

    Lane 1: Rabbit control IgG (1 µg) in HeLa whole cell lysate.

    Lane 2: ab236601 (6 µg) in HeLa whole cell lysate.

    Lane 3: HeLa whole cell lysate (10 µg input).

    For western blotting an HRP-conjugated Protein G antibody was used as the secondary antibody at a 1/2000 dilution.

  • Paraffin-embedded human liver cancer tissue stained for Casein Kinase 1 delta/CSNK1D with ab236601 at a 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human lymph node tissue stained for Casein Kinase 1 delta/CSNK1D with ab236601 at a 1/1000 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab236601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up