Overview

  • Product name

    Anti-Casein Kinase 1 gamma 2 antibody
    See all Casein Kinase 1 gamma 2 primary antibodies
  • Description

    Rabbit polyclonal to Casein Kinase 1 gamma 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Casein Kinase 1 gamma 2 aa 316-415.
    Sequence:

    FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALN STNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK


    Database link: P78368

  • Positive control

    • WB: Mouse gonadal tissue; HeLa whole cell lysate. IHC-P: Human testis tissue and human breast cancer tissue. IP: HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab230045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity). Phosphorylates COL4A3BP/CERT, MTA1 and SMAD3. Involved in brain development and vesicular trafficking and neurotransmitter releasing from small synaptic vesicles. Regulates fast synaptic transmission mediated by glutamate. SMAD3 phosphorylation promotes its ligand-dependent ubiquitination and subsequent proteasome degradation, thus inhibiting SMAD3-mediated TGF-beta responses. Hyperphosphorylation of the serine-repeat motif of COL4A3BP/CERT leads to its inactivation by dissociation from the Golgi complex, thus down-regulating ER-to-Golgi transport of ceramide and sphingomyelin synthesis.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Casein kinase 1, gamma 2 antibody
    • Casein kinase I isoform gamma 2 antibody
    • Casein kinase I isoform gamma-2 antibody
    • CK1g2 antibody
    • CKI gamma 2 antibody
    • CKI-gamma 2 antibody
    • CSNK1G 2 antibody
    • Csnk1g2 antibody
    • KC1G2_HUMAN antibody
    see all

Images

  • All lanes : Anti-Casein Kinase 1 gamma 2 antibody (ab230045) at 1/1000 dilution

    Lane 1 : Mouse gonadal tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

  • Casein Kinase 1 gamma 2 was immunoprecipitated from 500 µg HeLa epithelial cell line from cervix adenocarcinoma) whole cell lysate with 4 µg of ab230045. Western blot was performed from the immunoprecipitate using ab230045 at 1/1000 dilution.

    Lane 1: 1 µg of Rabbit monoclonal IgG instead of ab230045 in HeLa whole cell lysate.
    Lane 2: ab230045 IP in HeLa whole cell lysate.
    Lane 3: HeLa whole cell lysate 20 µg (input).

    For western blotting, an HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG was used the secondary antibody (1/50,000).

  • Paraffin-embedded human breast cancer tissue stained for Casein Kinase 1 gamma 2 using ab230045 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for Casien Kinase 1 gamma 2 using ab230045 at 1/100 dilution in immunohistochemical analysis.

References

ab230045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up