Overview

  • Product name

  • Description

    Rabbit polyclonal to CASK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CASK aa 283-421.
    Sequence:

    AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFS EDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYD KINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE


    Database link: O70589-3

  • Positive control

    • ICC/IF: U-251 MG cells. WB: RT4 cell lysate. IHC-P: Human duodenum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Multidomain scaffolding protein with a role in synaptic transmembrane protein anchoring and ion channel trafficking. Contributes to neural development and regulation of gene expression via interaction with the transcription factor TRB1. Binds to cell-surface proteins, including amyloid precursor protein, neurexins and syndecans. May mediate a link between the extracellular matrix and the actin cytoskeleton via its interaction with syndecan and with the actin/spectrin-binding protein 4.1.
  • Tissue specificity

    Ubiquitous. Expression is significantly greater in brain relative to kidney, lung, and liver and in fetal brain and kidney relative to lung and liver.
  • Involvement in disease

    Defects in CASK are the cause of mental retardation X-linked CASK-related (MRXCASK) [MIM:300749]. Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Patients with mental retardation X-linked CASK-related can manifest a severe phenotype consisting of severe intellectual deficit, congenital or postnatal microcephaly, disproportionate brainstem and cerebellar hypoplasia (MICPCH Syndrome). A milder phenotype consists of mental retardation alone or associated with nystagmus.
    Defects in CASK are the cause of FG syndrome type 4 (FGS4) [MIM:300422]. FG syndrome (FGS) is an X-linked disorder characterized by mental retardation, relative macrocephaly, hypotonia and constipation.
  • Sequence similarities

    In the N-terminal section; belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 2 L27 domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
    Contains 1 SH3 domain.
  • Domain

    The first L27 domain binds DLG1 and the second L27 domain probably binds LIN7.
    The protein kinase domain mediates the interaction with FCHSD2.
  • Cellular localization

    Nucleus. Cytoplasm. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAGH39 antibody
    • Caki antibody
    • Calcium/calmodulin dependent serine protein kinase antibody
    • Calcium/calmodulin dependent serine protein kinase (MAGUK family) antibody
    • Calcium/calmodulin dependent serine protein kinase membrane associated guanylate kinase antibody
    • Calcium/calmodulin-dependent serine protein kinase antibody
    • CAMGUK antibody
    • CAMGUK protein antibody
    • CAMGUK, drosophila, homolog of antibody
    • casK antibody
    • CMG antibody
    • CSKP_HUMAN antibody
    • DXPri1 antibody
    • DXRib1 antibody
    • FGS4 antibody
    • FLJ22219 antibody
    • FLJ31914 antibody
    • hCASK antibody
    • LIN 2 antibody
    • Lin 2 homolog antibody
    • LIN2 antibody
    • Lin2 homolog antibody
    • MICPCH antibody
    • MRXSNA antibody
    • Pals3 antibody
    • Peripheral plasma membrane protein CASK antibody
    • Protein lin-2 homolog antibody
    • TNRC8 antibody
    • Trinucleotide repeat containing 8 antibody
    • Vertebtate LIN2 homolog antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for CASK (green) using ab244393 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human duodenum tissue stained for CASK using ab244393 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for CASK using ab244393 at 1/20 dilution in immunohistochemical analysis.

    Low expression as expected.

  • Anti-CASK antibody (ab244393) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate

References

ab244393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up