Overview

  • Product name

  • Description

    Rabbit polyclonal to Caspase-14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat Caspase-14 aa 1-246. Expressed in E.coli.
    Sequence:

    MDSETINPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYL KFESTMKRDPTAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLK GEDGNMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPGEELPGD ELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKGSGFIQTLTDVFI HKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLRKKLYLQ


    Database link: D3ZZ65

  • Positive control

    • WB: Recombinant rat Caspase-14; rat skin tissue lysate. IHC-P: Rat skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/0.2 - 1/2. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Believed to be a non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and cornification. Probably regulates maturation of the epidermis by proteolytically processing filaggrin.
  • Tissue specificity

    Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only expressed at very low levels.
  • Sequence similarities

    Belongs to the peptidase C14A family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptosis related cysteine protease antibody
    • CASP 14 antibody
    • CASP-14 antibody
    • CASP14 antibody
    • Caspase 14 apoptosis related cysteine protease antibody
    • Caspase 14 precursor antibody
    • Caspase-14 subunit p10 antibody
    • Caspase14 antibody
    • CASPE_HUMAN antibody
    • MGC119078 antibody
    • MGC119079 antibody
    • MICE antibody
    • Mini ICE antibody
    see all

Images

  • Anti-Caspase-14 antibody (ab231071) at 2 µg/ml + Recombinant rat Caspase-14

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Developed using the ECL technique.

    Predicted band size: 28 kDa

  • Anti-Caspase-14 antibody (ab231071) at 2 µg/ml + Rat skin tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Developed using the ECL technique.

    Predicted band size: 28 kDa

  • Formalin-fixed, paraffin-embedded rat skin tissue stained for Caspase-14 with ab231071 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up