Overview

  • Product name

    Anti-Caspase-3 antibody [ABM1C12]
    See all Caspase-3 primary antibodies
  • Description

    Mouse monoclonal [ABM1C12] to Caspase-3
  • Host species

    Mouse
  • Specificity

    ab208161 recognizes both pro- and active Caspase 3 after apoptosis has been induced in wildtype cells and not knockout cells
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Hamster, Cat, Dog, Pig, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Caspase-3 aa 1-277.
    Sequence:

    MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIII NNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELM DSVSKEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRS LTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTA PGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESF SLDSTFHAKKQIPCIVSMLTKELYFYH


    Database link: P70677

  • Positive control

    • Ramos cell lysate. Human colon, adenocarcinoma of rectum, spleen and squamous cell carcinoma of lung tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab208161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 31 kDa.
IHC-P Use a concentration of 5 µg/ml.

Target

  • Function

    Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-
    -Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin.
  • Tissue specificity

    Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system.
  • Sequence similarities

    Belongs to the peptidase C14A family.
  • Post-translational
    modifications

    Cleavage by granzyme B, caspase-6, caspase-8 and caspase-10 generates the two active subunits. Additional processing of the propeptides is likely due to the autocatalytic activity of the activated protease. Active heterodimers between the small subunit of caspase-7 protease and the large subunit of caspase-3 also occur and vice versa.
    S-nitrosylated on its catalytic site cysteine in unstimulated human cell lines and denitrosylated upon activation of the Fas apoptotic pathway, associated with an increase in intracellular caspase activity. Fas therefore activates caspase-3 not only by inducing the cleavage of the caspase zymogen to its active subunits, but also by stimulating the denitrosylation of its active site thiol.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • A830040C14Rik antibody
    • Apopain antibody
    • CASP 3 antibody
    • CASP-3 antibody
    • CASP3 antibody
    • CASP3_HUMAN antibody
    • Casp3a antibody
    • Caspase 3 antibody
    • Caspase 3, apoptosis-related cysteine peptidase antibody
    • Caspase 3, apoptosis-related cysteine protease antibody
    • Caspase 3, apoptosis-related cysteine protease a antibody
    • Caspase-3 subunit p12 antibody
    • Caspase3 antibody
    • CC3 antibody
    • CPP 32 antibody
    • CPP-32 antibody
    • CPP32 antibody
    • CPP32B antibody
    • Cysteine protease CPP32 antibody
    • EC 3.4.22.56 antibody
    • ICE3 antibody
    • LICE antibody
    • mldy antibody
    • OTTHUMP00000165052 antibody
    • OTTHUMP00000165053 antibody
    • OTTHUMP00000165054 antibody
    • PARP cleavage protease antibody
    • Procaspase3 antibody
    • Protein Yama antibody
    • SCA 1 antibody
    • SCA-1 antibody
    • SCA1 antibody
    • SREBP cleavage activity 1 antibody
    • Yama antibody
    • Yama protein antibody
    see all

Images

  • Lane 1: Wild-type HAP1 cell lysate + Staurosporine (1μM for 4h)
    Lane 2: Wild-type HAP1 cell lysate
    Lane 3: Caspase-3 knockout HAP1 cell lysate + Staurosporine (1μM for 4h)
    Lane 4: Caspase-3 knockout HAP1 cell lysate
    Lanes 1 - 4: Merged signal (red and green). Green - ab208161 observed at 35 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab208161 was shown to recognise pro + active Caspase 3 when Caspase 3 knockout samples were used, along with additional cross-reactive bands. Wild-type and Caspase 3 knockout samples (± Staurosporine treatment) were subjected to SDS-PAGE. ab208161 at a concentration of 2 µg/ml and ab181602 (loading control to GAPDH) at a dilution of 1/10000 were incubated overnight at 4°C. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) and Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) secondary antibodies at 1/10000 dilution for 1 hour at room temperature before imaging.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human adenocarcinoma of rectum tissue labeling active + pro Caspase 3 with ab208161 at 5 µg/ml .

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon tissue labeling active + pro Caspase 3 with ab208161 at 5 µg/ml .

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human spleen tissue labeling active + pro Caspase 3 with ab208161 at 5 µg/ml .

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human squamous cell carcinoma of lung tissue labeling active + pro Caspase 3 with ab208161 at 5 µg/ml .

  • Anti-Caspase-3 antibody [ABM1C12] (ab208161) at 2 µg/ml + Ramos cell lysate

    Predicted band size: 31 kDa

References

This product has been referenced in:

  • Zhang Y  et al. Ailanthone up-regulates miR-449a to restrain acute myeloid leukemia cells growth, migration and invasion. Exp Mol Pathol 108:114-120 (2019). Read more (PubMed: 31002772) »
  • Li XF  et al. Downregulation of the long noncoding RNA MBNL1-AS1 protects sevoflurane-pretreated mice against ischemia-reperfusion injury by targeting KCNMA1. Exp Mol Med 50:115 (2018). Read more (PubMed: 30185781) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up