Overview

  • Product name

  • Description

    Rabbit polyclonal to Caspase-4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Bovine Caspase-4 aa 81-270. (Expressed in E.coli).
    Sequence:

    KNSTSIKAPEETVAGPDESVGSAATLKLCPHEEFLKLCKERAGEIYPIKE RKDRTRLALIICNTEFDHMPPRNGAALDILGMKQLLEGLGYTVEVEEKLT ARDMESVLWKFAAREEHKSSDSTFLVFMSHGILDGICGTMHSEEEPDVLP YDTIFRTFNNRNCLSLKDKPKVIIVQACRGANRGELWVSD


    Database link: Q5E9C1

  • Positive control

    • Mouse liver lysate; Cow serum; Recombinant cow Caspase 4 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves caspase-1.
  • Tissue specificity

    Widely expressed, with highest levels in spleen and lung. Moderate expression in heart and liver, low expression in skeletal muscle, kidney and testis. Not found in the brain.
  • Sequence similarities

    Belongs to the peptidase C14A family.
    Contains 1 CARD domain.
  • Post-translational
    modifications

    The two subunits are derived from the precursor sequence by an autocatalytic mechanism or by cleavage by Caspase-8.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptotic cysteine protease Mih1/TX antibody
    • CASP-4 antibody
    • CASP4 antibody
    • CASP4_HUMAN antibody
    • Caspase 4 apoptosis related cysteine peptidase antibody
    • Caspase-4 subunit 2 antibody
    • Caspase4 antibody
    • ICE(rel)-II antibody
    • ICE(rel)II antibody
    • ICEREL II antibody
    • ICH2 antibody
    • Mih1/TX antibody
    • Protease ICH-2 antibody
    • Protease TX antibody
    • TX antibody
    see all

Images

  • Anti-Caspase-4 antibody (ab232715) at 5 µg/ml + Mouse liver lysate
  • Anti-Caspase-4 antibody (ab232715) at 5 µg/ml + Cow serum
  • Anti-Caspase-4 antibody (ab232715) at 2 µg/ml + Recombinant cow Caspase 4 protein

References

ab232715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up