Overview

  • Product name

    Anti-Caspase-7 antibody [4D10B2]
    See all Caspase-7 primary antibodies
  • Description

    Mouse monoclonal [4D10B2] to Caspase-7
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Caspase-7 aa 29-198. (Purified from E.coli).
    Sequence:

    SSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNF DKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASE EDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKP KLFFIQACRGTELDDGIQAD


    Database link: P55210

  • Positive control

    • Human Caspase-7 (aa29-198) recombinant protein; Caspase-7 (aa29-198)-hIgGFc transfected HEK293 cell lysate; Jurkat, HEK293, MOLT4, MCF 7 and PC-12 cell lysates; MCF7 cells; Human cervical cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab201959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-
    -Gly-217' bond. Overexpression promotes programmed cell death.
  • Tissue specificity

    Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.
  • Sequence similarities

    Belongs to the peptidase C14A family.
  • Post-translational
    modifications

    Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptotic protease Mch-3 antibody
    • Apoptotic protease MCH3 antibody
    • CASP-7 antibody
    • CASP7 antibody
    • CASP7_HUMAN antibody
    • Caspase 7 antibody
    • Caspase 7 apoptosis related cysteine peptidase antibody
    • Caspase-7 subunit p11 antibody
    • Caspase7 antibody
    • CMH 1 antibody
    • CMH-1 antibody
    • CMH1 antibody
    • ICE LAP3 antibody
    • ICE-LAP3 antibody
    • ICE-like apoptotic protease 3 antibody
    • LICE2 antibody
    • MCH3 antibody
    see all

Images

  • Lane 1: Wild type HAP1 whole cell lysate (20 µg)
    Lane 2: HAP1 + Staurosporin knockout HAP1 whole cell lysate (20 µg)
    Lane 3: CASP7 whole cell lysate (20 µg)
    Lane 4: CASP7 + Staurosporin whole cell lysate (20 µg)
    Lane 5: HeLa whole cell lysate (20 µg)
    Lane 6: HeLa + Staurosporin whole cell lysate (20 µg)

    Lanes 1 - 6: Merged signal (red and green). Green - ab201959 observed at 38,20 kDa. Red - loading control, ab176560, observed at 50 kDa.

    ab201959 was shown to specifically react with HAP1 + Staurosporin when HAP1 + Staurosporin knockout samples were used. Wild-type and HAP1 + Staurosporin knockout samples were subjected to SDS-PAGE. Ab201959 and ab176560 (Rabbit anti alpha Tubulin loading control) were incubated overnight at 4°C at 1000 dilution and 1/10000 dilution respectively. Blots were developed with Goat anti-Rabbit IgG H&L (IRDye® 800CW) preabsorbed ab216773 and Goat anti-Mouse IgG H&L (IRDye® 680RD) preabsorbed ab216776 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.

  • Anti-Caspase-7 antibody [4D10B2] (ab201959) at 1/500 dilution + Human Caspase-7 (aa29-198) recombinant protein

    Predicted band size: 34 kDa
    Observed band size: 22 kDa
    why is the actual band size different from the predicted?



    Expected MWt is 22.5 kDa.

  • All lanes : Anti-Caspase-7 antibody [4D10B2] (ab201959) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Caspase-7 (aa29-198)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 34 kDa

  • All lanes : Anti-Caspase-7 antibody [4D10B2] (ab201959) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : HEK293 cell lysate
    Lane 3 : MOLT4 cell lysate
    Lane 4 : MCF7 cell lysate
    Lane 5 : PC12 cell lysate

    Predicted band size: 34 kDa

  • Flow cytometric analysis of MCF7 cells labeling Caspase -7 with ab201959 at 1/200 dilution (green) compared to a negative control (red).

  • Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling Caspase-7 with ab201959 at 1/200 dilution.

References

This product has been referenced in:

  • Zhang C  et al. Growth of tyrosine kinase inhibitor-resistant Philadelphia-positive acute lymphoblastic leukemia: Role of bone marrow stromal cells. Oncol Lett 13:2059-2070 (2017). WB . Read more (PubMed: 28454362) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up