Overview

  • Product name

  • Description

    Rabbit polyclonal to CAST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CAST aa 289-404.
    Sequence:

    KRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMA MMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPKKKTK KEKQQDATVEPETEVV


    Database link: O15446

  • Positive control

    • IHC-P: Human breast cancer tissue. ICC/IF: HeLa cells.
  • General notes

    Previously labelled as PAF49.

Properties

Applications

Our Abpromise guarantee covers the use of ab236662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation.
    Isoform 2 has been described as a component of preformed T-cell receptor (TCR) complex.
  • Sequence similarities

    Belongs to the eukaryotic RPA34 RNA polymerase subunit family.
  • Post-translational
    modifications

    Isoform 2 undergoes tyrosine phosphorylation upon T-cell receptor (TCR) stimulation. This phosphorylation has not been confirmed by other group.
    Isoform 1 is phosphorylated on tyrosine residues in initiation-competent Pol I-beta complexes but not in Pol I-alpha complexes.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus. Chromosome. Found at the fibrillar centers of the nucleolus in interphase and during cell division it is localized to the nucleolus organizer regions of the chromosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • A34.5 antibody
    • Anti sense to ERCC 1 protein antibody
    • Antisense to ERCC-1 protein antibody
    • ASE 1 antibody
    • ASE-1 antibody
    • ASE1 antibody
    • CAST antibody
    • CD3 epsilon associated protein antibody
    • CD3-epsilon-associated protein antibody
    • CD3E antigen, epsilon polypeptide associated protein antibody
    • CD3E associated protein antibody
    • CD3e molecule, epsilon associated protein antibody
    • CD3E-associated protein antibody
    • CD3EAP antibody
    • DNA directed RNA polymerase I subunit RPA34 antibody
    • DNA-directed RNA polymerase I subunit RPA34 antibody
    • MGC118851 antibody
    • PAF 49 antibody
    • PAF49 antibody
    • RNA polymerase I associated factor PAF49 antibody
    • RNA polymerase I-associated factor PAF49 antibody
    • RPA34_HUMAN antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for CAST using ab236662 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for CAST using ab236662 at a dilution of 1/66 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up