For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    cat1-antibody-ab37588.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels More Ion Channels
Share by email

Anti-CAT1 antibody (ab37588)

  • Datasheet
  • SDS
Reviews (3)Q&A (1)References (9)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-CAT1 antibody (ab37588)

    Key features and details

    • Rabbit polyclonal to CAT1
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant Human CAT1 protein (ab152687)
    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    Primary
    Product image
    Alexa Fluor® 488 Anti-IL-4 antibody [EPR1118Y] (ab211374)

    View more associated products

    Overview

    • Product name

      Anti-CAT1 antibody
    • Description

      Rabbit polyclonal to CAT1
    • Host species

      Rabbit
    • Tested Applications & Species

      Application Species
      WB
      Human
      See all applications and species data
    • Immunogen

      Synthetic peptide. This information is proprietary to Abcam and/or its suppliers.

    • Positive control

      • WB: Jurkat, MCF7, and HepG2 whole cell lysates.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.40
      Preservative: 0.02% Sodium azide
      Constituent: PBS

      Batches of this product that have a concentration < 1mg/ml may have BSA added as a stabilising agent. If you would like information about the formulation of a specific lot, please contact our scientific support team who will be happy to help.
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Neuroscience
      • Neurotransmission
      • Receptors / Channels
      • More Ion Channels
      • Signal Transduction
      • Metabolism
      • Plasma Membrane
      • Channels
      • Metabolism
      • Types of disease
      • Cancer

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Recombinant Protein

      • Recombinant Human CAT1 protein (ab152687)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab37588 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    WB
    Human
    All applications
    Mouse
    Orangutan
    Application Abreviews Notes
    WB
    1/250. Detects a band of approximately 68 kDa (predicted molecular weight: 68 kDa).

    Abcam recommends using milk as the blocking agent.

    Notes
    WB
    1/250. Detects a band of approximately 68 kDa (predicted molecular weight: 68 kDa).

    Abcam recommends using milk as the blocking agent.

    Target

    • Function

      High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor.
    • Tissue specificity

      Ubiquitous.
    • Sequence similarities

      Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P30825 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 6541 Human
      • Entrez Gene: 11987 Mouse
      • Omim: 104615 Human
      • SwissProt: P30825 Human
      • SwissProt: Q09143 Mouse
      • Unigene: 14846 Human
      • Unigene: 275489 Mouse
      • Alternative names

        • Amino acid transporter cationic 1 antibody
        • ATRC1 antibody
        • CAT-1 antibody
        • CaT1 antibody
        • CTR1_HUMAN antibody
        • Ecotropic retroviral leukemia receptor homolog antibody
        • Ecotropic retroviral receptor antibody
        • Ecotropic retrovirus receptor homolog antibody
        • ERR antibody
        • HCAT1 antibody
        • High affinity cationic amino acid transporter 1 antibody
        • High-affinity cationic amino acid transporter-1 antibody
        • REC1L antibody
        • Slc7a1 antibody
        • Solute carrier family 7 (cationic amino acid transporter, y+ system) member 1 antibody
        • Solute carrier family 7 member 1 antibody
        • System Y+ basic amino acid transporter antibody
        see all

      Images

      • Western blot - Anti-CAT1 antibody (ab37588)
        Western blot - Anti-CAT1 antibody (ab37588)
        All lanes : Anti-CAT1 antibody (ab37588) at 1 µg/ml

        Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
        Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
        Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

        Lysates/proteins at 20 µg per lane.

        Secondary
        All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/50000 dilution

        Developed using the ECL technique.

        Performed under reducing conditions.

        Predicted band size: 68 kDa
        Observed band size: 68 kDa
        Additional bands at: 120 kDa (possible non-specific binding)


        Exposure time: 4 minutes


        This blot was produced using a 4-12% Bis-tris gel under the MOPS buffer system. The gel was run at 200V for 50 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using 3% Milk before being incubated with ab37588 overnight at 4°C. Antibody binding was detected using an anti-rabbit antibody conjugated to HRP, and visualised using ECL development solution ab133406.

      Protocols

      • Western blot protocols
      • Immunohistochemistry protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
      • SDS
    • References (9)

      Publishing research using ab37588? Please let us know so that we can cite the reference in this datasheet.

      ab37588 has been referenced in 9 publications.

      • Augusto L  et al. Regulation of arginine transport by GCN2 eIF2 kinase is important for replication of the intracellular parasite Toxoplasma gondii. PLoS Pathog 15:e1007746 (2019). PubMed: 31194856
      • Persson P  et al. Cellular transport of l-arginine determines renal medullary blood flow in control rats, but not in diabetic rats despite enhanced cellular uptake capacity. Am J Physiol Renal Physiol 312:F278-F283 (2017). PubMed: 27927650
      • Mitchell CJ  et al. Minimal dose of milk protein concentrate to enhance the anabolic signalling response to a single bout of resistance exercise; a randomised controlled trial. J Int Soc Sports Nutr 14:17 (2017). WB ; Human . PubMed: 28603468
      • Sheen JM  et al. Combined Intraperitoneal and Intrathecal Etanercept Reduce Increased Brain Tumor Necrosis Factor-Alpha and Asymmetric Dimethylarginine Levels and Rescues Spatial Deficits in Young Rats after Bile Duct Ligation. Front Cell Neurosci 10:167 (2016). WB . PubMed: 27445694
      • Kishikawa T  et al. Decreased miR122 in hepatocellular carcinoma leads to chemoresistance with increased arginine. Oncotarget 6:8339-52 (2015). PubMed: 25826076
      • Wang X  et al. Arginine decarboxylase and agmatinase: an alternative pathway for de novo biosynthesis of polyamines for development of mammalian conceptuses. Biol Reprod 90:84 (2014). PubMed: 24648395
      • Wang X  et al. Functional role of arginine during the peri-implantation period of pregnancy. II. Consequences of loss of function of nitric oxide synthase NOS3 mRNA in ovine conceptus trophectoderm. Biol Reprod 91:59 (2014). PubMed: 25061098
      • Battisti S  et al. Nutritional stress and arginine auxotrophy confer high sensitivity to chloroquine toxicity in mesothelioma cells. Am J Respir Cell Mol Biol 46:498-506 (2012). PubMed: 22074703
      • Barilli A  et al. Arginine transport in human monocytic leukemia THP-1 cells during macrophage differentiation. J Leukoc Biol : (2011). WB ; Human . PubMed: 21586674

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      1-4 of 4 Abreviews or Q&A

      Flow Cytometry abreview for Anti-CAT1 antibody

      Excellent
      Abreviews
      Abreviews
      abreview image
      Application
      Flow Cytometry
      Sample
      Human Cell (CAT1-overexpressing HCT116 cells)
      Permeabilization
      No
      Gating Strategy
      Live cells
      Specification
      CAT1-overexpressing HCT116 cells
      Fixation
      No fixation
      Read More

      Abcam user community

      Verified customer

      Submitted Oct 27 2017

      Question

      We're looking for an antibody that targets the mouse Slc7a1 receptor for immunocytochemistry. Your AB37588 antibody shows that it reacts with this receptor in the mouse species, along with AB123956 which reacts with the human receptor. I have several questions:

      1. Will both of these antibodies react with the mouse Slc7a1 receptor for purposes of immunocytochemistry or immunohistochemistry? If yes, do you have any images you can send for examples of its application?


      2. What is the amino acid sequence and species of the immunogen?



      3. Can you recommend a more effective antibody to label the mouse receptor, if you carry one?



      4. Are you aware of any publications that have used these specific Abs? If yes, could you supply any relevant references?


      5. Do you currently have thee eantibodies in stock?



      6. Do you sell sample sizes?


      7. Do you have a Canadian distributor?

      Read More

      Abcam community

      Verified customer

      Asked on Jun 25 2012

      Answer

      Thank you for contacting us.

      The anti-SLC7A1 antibody ab37588 has been tested for reactivity with PFA-fixed, frozen mouse spinal chord by IHC. An image of the stain and a brief description of the protocol are available on the online datasheet. We are not aware of any other IHC or ICC testing. We know of one publication that used ab37588, and it is listed at the bottom of the online datasheet.

      Click here (or use the following: https://www.abcam.com/CAT1-antibody-ab37588.html).

      The immunogen for ab37588 is 76% conserved in the mouse protein,

      http://www.uniprot.org/uniprot/Q09143.

      The antibody ab123956 has not, to our knowledge, been tested for reactivity with mouse samples or in any application other than western blotting. We are not aware of any publications for this antibody.

      The human amino acid range that the immunogen is derived from, aa 428-457, LVLRYQPEQPNLVYQMASTSDELDPADQNE, has 83% identity with the mouse protein.

      I am waiting for the originating laboratory to send alignment results for the exact immunogen sequence, contained within the range above.

      Antibody ab37588 is in stock and available for delivery 2 days after placing your order directly with Abcam. Antibody ab123956 is not in stock and will be delivered 1-2 weeks after placing your order. Orders can also be placed through our Canadian distributor, Cedarlane, but we recommend placing orders directly through Abcam for fastest delivery.

      We do not have samples sizes for the antibodies. We do have a testing discount program for untested applications and species, which are not covered by our guarantee.

      I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information about the testing discount program.

      Read More

      Abcam Scientific Support

      Answered on Jun 25 2012

      Flow Cytometry abreview for Anti-CAT1 antibody

      Inconclusive
      Abreviews
      Abreviews
      Application
      Flow Cytometry
      Sample
      Mouse Cell (T cell)
      Specification
      T cell
      Permeabilization
      No
      Gating Strategy
      living cells
      Read More

      Ms. Beck

      Verified customer

      Submitted Sep 09 2011

      Immunohistochemistry (PFA perfusion fixed frozen sections) abreview for Anti-CAT1 antibody

      Excellent
      Abreviews
      Abreviews
      abreview image
      Application
      Immunohistochemistry (PFA perfusion fixed frozen sections)
      Sample
      Mouse Tissue sections (Spinal cord)
      Specification
      Spinal cord
      Read More

      Dr. Sophie Pezet

      Verified customer

      Submitted May 17 2011

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.