
  • Product name
    Anti-CAT1 antibody
  • Description
    Rabbit polyclonal to CAT1
  • Host species
  • Tested applications
    Suitable for: IHC-FoFr, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Synthetic peptide conjugated to KLH derived from within residues 600 to the C-terminus of Human CAT1 (gene: SLC7A1).

    Read Abcam's proprietary immunogen policy (Peptide available as ab37587.)

  • Positive control
    • This antibody gave a positive signal in the following human whole cell lysates: Jurkat, MCF-7 and HepG2.



Our Abpromise guarantee covers the use of ab37588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-FoFr 1/1000.
WB 1/250. Detects a band of approximately 68 kDa (predicted molecular weight: 68 kDa).

Abcam recommends using milk as the blocking agent.


  • Function
    High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor.
  • Tissue specificity
  • Sequence similarities
    Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • Amino acid transporter cationic 1 antibody
    • ATRC1 antibody
    • CAT-1 antibody
    • CaT1 antibody
    • CTR1_HUMAN antibody
    • Ecotropic retroviral leukemia receptor homolog antibody
    • Ecotropic retroviral receptor antibody
    • Ecotropic retrovirus receptor homolog antibody
    • ERR antibody
    • HCAT1 antibody
    • High affinity cationic amino acid transporter 1 antibody
    • High-affinity cationic amino acid transporter-1 antibody
    • REC1L antibody
    • Slc7a1 antibody
    • Solute carrier family 7 (cationic amino acid transporter, y+ system) member 1 antibody
    • Solute carrier family 7 member 1 antibody
    • System Y+ basic amino acid transporter antibody
    see all


  • All lanes : Anti-CAT1 antibody (ab37588) at 1 µg/ml

    Lane 1 : Jurkat (Human) Whole Cell Lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate
    Lane 3 : PC3 (Human prostate carcinoma cell line) Whole Cell Lysate
    Lane 4 : LNCaP (Human prostate carcinoma) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/50000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 68 kDa
    Observed band size: 68 kDa
    Additional bands at: 160 kDa, 76 kDa. We are unsure as to the identity of these extra bands.

    Exposure time: 1 minute

    This blot was produced using a 4-12% Bis-tris gel under the MOPS buffer system. The gel was run at 200V for 50 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using 3% Milk before being incubated with ab37588 overnight at 4°C. Antibody binding was detected using an anti-rabbit antibody conjugated to HRP, and visualised using ECL development solution ab133406.

    Abcam recommends using milk as the blocking agent. Abcam welcomes customer feedback and would appreciate any comments regarding this product and the data presented above.

  • All lanes : Anti-CAT1 antibody (ab37588) at 1 µg/ml

    Lane 1 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate
    Lane 3 : HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilution

    Performed under reducing conditions.

    Predicted band size: 68 kDa
    Observed band size: 68 kDa

  • All lanes : Anti-CAT1 antibody (ab37588) at 1 µg/ml (3% Milk)

    Lane 1 : Jurkat (Human T cell lymphoblast-like cell line) Whole Cell Lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell Lysate
    Lane 3 : HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    All lanes : Goat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/50000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 68 kDa
    Observed band size: 68 kDa
    Additional bands at: 135 kDa, 155 kDa, 76 kDa. We are unsure as to the identity of these extra bands.

    Exposure time: 2 minutes

    This blot was produced using a 4-12% Bis-tris gel under the MOPS buffer system. The gel was run at 200V for 50 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using 3% Milk before being incubated with ab37588 overnight at 4°C. Antibody binding was detected using an anti-rabbit antibody conjugated to HRP, and visualised using ECL development solution ab133406.

    Abcam recommends using milk as the blocking agent. Abcam welcomes customer feedback and would appreciate any comments regarding this product and the data presented above.

  • IHC-FoFr image of CAT1 staining on Mouse Spinal Cord sections using ab37588 (1:1000). The sections used came from animals perfused fixed with Paraformaldehyde 4% with 15% of a solution of saturated picric acid, in phosphate buffer 0.1M. Following postfixation in the same fixative overnight, the spinal cord were cryoprotected in sucrose 30% overnight. Spinal cords were then cut using a cryostat and the immunostainings were performed using the ‘free floating’ technique.

    See Abreview


This product has been referenced in:
  • Mitchell CJ  et al. Minimal dose of milk protein concentrate to enhance the anabolic signalling response to a single bout of resistance exercise; a randomised controlled trial. J Int Soc Sports Nutr 14:17 (2017). WB ; Human . Read more (PubMed: 28603468) »
  • Sheen JM  et al. Combined Intraperitoneal and Intrathecal Etanercept Reduce Increased Brain Tumor Necrosis Factor-Alpha and Asymmetric Dimethylarginine Levels and Rescues Spatial Deficits in Young Rats after Bile Duct Ligation. Front Cell Neurosci 10:167 (2016). WB . Read more (PubMed: 27445694) »
See all 7 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Flow Cytometry
Human Cell (CAT1-overexpressing HCT116 cells)
Gating Strategy
Live cells
CAT1-overexpressing HCT116 cells
No fixation

Abcam user community

Verified customer

Submitted Oct 27 2017


Thank you for contacting us.

The anti-SLC7A1 antibody ab37588 has been tested for reactivity with PFA-fixed, frozen mouse spinal chord by IHC. An image of the stain and a brief description of the protocol are available on the online datasheet. We are not aware of any other IHC or ICC testing. We know of one publication that used ab37588, and it is listed at the bottom of the online datasheet.

Click here (or use the following: https://www.abcam.com/index.html?datasheet=37588).

The immunogen for ab37588 is 76% conserved in the mouse protein,


The antibody ab123956 has not, to our knowledge, been tested for reactivity with mouse samples or in any application other than western blotting. We are not aware of any publications for this antibody.

The human amino acid range that the immunogen is derived from, aa 428-457, LVLRYQPEQPNLVYQMASTSDELDPADQNE, has 83% identity with the mouse protein.

I am waiting for the originating laboratory to send alignment results for the exact immunogen sequence, contained within the range above.

Antibody ab37588 is in stock and available for delivery 2 days after placing your order directly with Abcam. Antibody ab123956 is not in stock and will be delivered 1-2 weeks after placing your order. Orders can also be placed through our Canadian distributor, Cedarlane, but we recommend placing orders directly through Abcam for fastest delivery.

We do not have samples sizes for the antibodies. We do have a testing discount program for untested applications and species, which are not covered by our guarantee.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information about the testing discount program.

Read More
Abcam has not validated the combination of species/application used in this Abreview.
Flow Cytometry
Mouse Cell (T cell)
T cell
Gating Strategy
living cells

Ms. Beck

Verified customer

Submitted Sep 09 2011

Abcam guarantees this product to work in the species/application used in this Abreview.
Immunohistochemistry (PFA perfusion fixed frozen sections)
Mouse Tissue sections (Spinal cord)
Spinal cord

Dr. Sophie Pezet

Verified customer

Submitted May 17 2011


Sign up