Overview

  • Product name

  • Description

    Rabbit polyclonal to Cathepsin B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Mouse Cathepsin B aa 300-333 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    WNLDWGDNGFFKILRGENHCGIESEIVAGIPRTD


    Database link: P10605

  • Positive control

    • Human esophageal carcinoma and rat brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab214197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • Amyloid precursor protein secretase antibody
    • APP secretase antibody
    • APPS antibody
    • CATB_HUMAN antibody
    • Cathepsin B heavy chain antibody
    • Cathepsin B1 antibody
    • CathepsinB antibody
    • CPSB antibody
    • CTSB antibody
    • cysteine protease antibody
    • OTTHUMP00000116009 antibody
    • OTTHUMP00000229510 antibody
    • OTTHUMP00000229511 antibody
    • OTTHUMP00000229512 antibody
    • OTTHUMP00000229514 antibody
    • OTTHUMP00000229515 antibody
    • OTTHUMP00000229516 antibody
    • Preprocathepsin B antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded rat brain tissue labeling Cathepsin B with ab214197 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human esophageal carcinoma tissue labeling Cathepsin B with ab214197 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up